SecReT6
Protein ID: 145299407
SecReT6 ID199
T6SS typei1
Gene symbolclpB2
Locus tagASA_2461
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2624208..2626850 [-]
Producttype VI secretion system clpB chaperone
NoteTssH
UniProt IDA4SNM8
KEGG IDasa:ASA_2461
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.90E-38, Aligned region: 222..322
AAA_2 [PF07724], Evalue: 2.90E-38, Aligned region: 617..778
AAA [PF00004], Evalue: 3.60E-18, Aligned region: 222..321
AAA [PF00004], Evalue: 3.60E-18, Aligned region: 554..578
AAA [PF00004], Evalue: 3.60E-18, Aligned region: 623..741
AAA [PF00004], Evalue: 3.60E-18, Aligned region: 793..832
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 222..249
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 622..742
ClpB_D2-small [PF10431], Evalue: 1.70E-13, Aligned region: 784..858
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 199..243
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 593..660
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 688..716
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 621..641
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 684..716
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 415..451
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 492..511
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 623..649
NACHT [PF05729], Evalue: 1.60E-05, Aligned region: 829..860
AAA_10 [PF12846], Evalue: 4.20E-05, Aligned region: 220..243
AAA_10 [PF12846], Evalue: 4.20E-05, Aligned region: 282..308
AAA_10 [PF12846], Evalue: 4.20E-05, Aligned region: 352..468
AAA_10 [PF12846], Evalue: 4.20E-05, Aligned region: 622..660
Arch_ATPase [PF01637], Evalue: 5.20E-05, Aligned region: 202..242
Arch_ATPase [PF01637], Evalue: 5.20E-05, Aligned region: 623..658
Arch_ATPase [PF01637], Evalue: 5.20E-05, Aligned region: 693..704
DUF258 [PF03193], Evalue: 7.60E-05, Aligned region: 189..240
DUF258 [PF03193], Evalue: 7.60E-05, Aligned region: 622..640
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 222..244
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 275..308
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 616..651
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 217..241
AAA_29 [PF13555], Evalue: 0.00022, Aligned region: 620..644
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 0.00025, Aligned region: 622..711
AAA_19 [PF13245], Evalue: 0.00044, Aligned region: 219..244
AAA_19 [PF13245], Evalue: 0.00044, Aligned region: 358..399
AAA_19 [PF13245], Evalue: 0.00044, Aligned region: 553..563
AAA_19 [PF13245], Evalue: 0.00044, Aligned region: 614..641
IstB_IS21 [PF01695], Evalue: 0.0014, Aligned region: 216..255
IstB_IS21 [PF01695], Evalue: 0.0014, Aligned region: 622..633
Clp_N [PF02861], Evalue: 0.002, Aligned region: 29..71
Clp_N [PF02861], Evalue: 0.002, Aligned region: 105..125
Sigma54_activat [PF00158], Evalue: 0.002, Aligned region: 220..238
Sigma54_activat [PF00158], Evalue: 0.002, Aligned region: 622..720
FtsK_SpoIIIE [PF01580], Evalue: 0.0022, Aligned region: 220..268
FtsK_SpoIIIE [PF01580], Evalue: 0.0022, Aligned region: 429..523
FtsK_SpoIIIE [PF01580], Evalue: 0.0022, Aligned region: 622..637
Zeta_toxin [PF06414], Evalue: 0.0029, Aligned region: 219..239
Zeta_toxin [PF06414], Evalue: 0.0029, Aligned region: 414..443
Zeta_toxin [PF06414], Evalue: 0.0029, Aligned region: 621..662
AAA_17 [PF13207], Evalue: 0.003, Aligned region: 222..264
AAA_17 [PF13207], Evalue: 0.003, Aligned region: 623..657
AAA_17 [PF13207], Evalue: 0.003, Aligned region: 800..825
MobB [PF03205], Evalue: 0.0031, Aligned region: 135..191
MobB [PF03205], Evalue: 0.0031, Aligned region: 222..246
MobB [PF03205], Evalue: 0.0031, Aligned region: 622..642
Ras [PF00071], Evalue: 0.0049, Aligned region: 222..235
Ras [PF00071], Evalue: 0.0049, Aligned region: 623..664
Protein Sequence: 880 a.a.     [Download]
>gi|145299407|ref|YP_001142248.1| clpB2 gene product [Aeromonas salmonicida subsp. salmonicida A449]
MIRIELPVLVERLNPICRHMLEEAAALCVNHQGAEIRIEHLLLKMLDTPLSDVRQILKRADVGVDELKTL
LQPAGADSGYAQGYPSFSPLLVEWLQDSWLLASAELQHAQLRSGVMLLVLLMTPQRYLPGSVTRLLANVN
RELLRQQFDEWVKESAETQVTVSTNGTSTQAALPADASLLARFTINVTEQARQGSLDPVLCRDHEIDLMI
DILSRRRKNNPIVVGEAGVGKSALIEGLALRIVADQVPEKLREVELMTLDLGAMQAGASVKGEFEKRFKG
VMQEVKEAVRPVILFIDEAHTLIGAGNQAGGLDVSNLIKPALARGELRTIAATTWGEYKKYVEKDAALSR
RFQLVKVGEPNADEATVILRGLRSIYEKAHGVLIDEEALQAATQLSARYISGRQLPDKAIDVLDTACARV
AINLTTPPRAVSHLQNALRQRELEIRQLERQSLIGLGDNTERLAELQSAQQTSRDALREQEAKWQQQQGL
VHQIVELRAALLADQQDEMLTREALDLADAPLDPQAAAEQLAGLERELAELQQGEVLVSAHVDKTQVAAV
IAEWTGVPLNRISQGELDVVTRLPEYLGELIKGLDVAVAHLHKHLLTARADLRRPGRPLGAFLLVGPSGV
GKTETVLQIAELMFGGRQYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEV
EKAHPDVLNLFYQAFDKGELADGEGRIIDCKNVVFFLTSNLGFQTIVDYAEQPDDLLNALYPELAAFFKP
ALLARMEVIPYLPLGHDTLVQIVGGKLNRLVKLLKERFGAEVVLEDEVAEEILRRANRSENGARMLESVI
DGALLPPVSLQLLQRLSAGEPIKRVRFSVSERQFVAEVEG
 
Nucleotide Sequence: 2643 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2626850-2624208 Aeromonas salmonicida subsp. salmonicida A449, complete genome
TTGATTCGTATAGAGCTACCCGTACTGGTGGAAAGACTCAACCCCATCTGTCGTCATATGCTGGAGGAGG
CTGCGGCCCTCTGCGTCAACCATCAGGGGGCGGAGATCCGCATCGAGCACCTGCTGCTCAAGATGCTGGA
TACCCCCTTGTCTGATGTACGCCAGATCCTCAAGCGGGCCGACGTCGGGGTCGACGAGCTCAAAACCCTG
CTCCAGCCTGCTGGTGCAGACAGTGGTTATGCCCAGGGTTACCCCTCCTTCTCGCCGCTCCTGGTGGAGT
GGTTGCAAGACAGCTGGCTGCTGGCTTCCGCCGAGCTGCAGCACGCCCAATTGCGCAGTGGCGTCATGCT
GCTGGTGCTCTTGATGACCCCCCAGCGTTACCTGCCAGGCTCTGTGACGCGCCTCTTGGCCAACGTCAAC
CGCGAGCTGTTGCGACAGCAGTTTGATGAGTGGGTGAAAGAGTCCGCCGAGACCCAAGTTACTGTTTCTA
CAAACGGCACCTCGACTCAGGCAGCCCTGCCAGCCGATGCCAGCCTGCTGGCCCGCTTTACCATCAACGT
GACCGAGCAGGCACGCCAGGGCAGCCTGGATCCCGTGCTTTGCCGGGATCACGAGATCGATCTGATGATC
GACATCCTCTCTCGGCGTCGCAAAAACAACCCCATCGTCGTGGGGGAGGCCGGGGTGGGCAAGAGCGCCC
TGATCGAGGGGCTGGCCCTGCGCATCGTGGCGGATCAGGTGCCTGAAAAATTGCGCGAGGTGGAGCTGAT
GACGCTCGACCTTGGTGCCATGCAGGCCGGTGCGTCGGTCAAGGGAGAGTTCGAGAAGCGCTTCAAGGGG
GTAATGCAGGAGGTCAAGGAGGCGGTGCGTCCTGTCATCCTCTTTATCGATGAGGCCCACACCCTGATCG
GGGCTGGCAATCAGGCCGGTGGGCTGGATGTCTCCAACCTCATCAAGCCGGCGCTGGCCCGGGGCGAGCT
GCGTACCATAGCCGCCACCACCTGGGGTGAGTACAAGAAATACGTGGAGAAAGATGCCGCCCTCTCGCGC
CGCTTCCAGCTGGTGAAGGTGGGCGAGCCCAATGCCGATGAGGCTACCGTGATCCTGCGCGGCCTGCGCA
GCATCTACGAAAAGGCCCATGGTGTGCTGATCGACGAAGAGGCGCTGCAAGCCGCTACCCAGCTTTCCGC
CCGTTATATTTCAGGTCGTCAGTTGCCGGACAAGGCGATCGACGTGCTCGATACCGCCTGTGCCCGGGTG
GCCATCAACCTGACTACGCCGCCGCGTGCCGTCAGCCATCTGCAAAACGCATTGCGTCAGCGTGAGCTGG
AGATCCGCCAGCTGGAGCGCCAGAGTCTGATCGGGCTGGGTGACAACACAGAGCGACTGGCCGAGCTGCA
GTCTGCCCAGCAGACCAGCCGTGATGCCCTGCGCGAGCAGGAAGCCAAGTGGCAGCAACAACAGGGGCTG
GTGCATCAGATTGTTGAACTGCGGGCCGCCCTGCTCGCCGATCAGCAGGATGAGATGCTGACCAGAGAGG
CGCTGGATCTCGCTGATGCGCCTCTGGATCCGCAAGCGGCTGCCGAGCAGCTTGCCGGGCTCGAGCGCGA
GCTGGCCGAGCTGCAACAGGGTGAGGTGCTGGTCTCGGCCCATGTCGACAAAACCCAGGTGGCGGCCGTG
ATCGCCGAGTGGACCGGGGTGCCGCTCAATCGCATCTCGCAAGGGGAGCTGGATGTGGTAACCCGGCTGC
CGGAGTACTTGGGCGAGCTTATCAAGGGGCTGGATGTGGCGGTGGCCCATCTGCACAAACACCTGCTGAC
CGCCCGCGCCGACTTGCGCCGCCCGGGCCGTCCGCTGGGGGCCTTCCTGCTGGTGGGGCCAAGCGGGGTC
GGCAAGACTGAAACTGTGTTGCAGATTGCCGAGCTGATGTTTGGCGGTCGCCAGTATCTGACCACCATCA
ACATGTCCGAGTATCAGGAAAAACACACAGTCTCCCGCCTGATCGGCTCGCCTCCCGGCTATGTCGGCTT
TGGCGAAGGGGGCGTGCTGACCGAAGCCATTCGTCAGAAACCCTATTCGGTGGTGCTGCTGGACGAGGTG
GAAAAAGCCCATCCGGACGTGCTCAACCTCTTCTATCAAGCGTTCGACAAGGGCGAGCTGGCCGACGGGG
AAGGGCGCATCATCGACTGCAAGAACGTGGTTTTCTTCCTCACCTCCAACCTCGGCTTCCAGACCATAGT
CGATTACGCCGAGCAGCCCGACGATCTGCTCAATGCGCTGTATCCGGAGCTGGCCGCCTTCTTCAAGCCG
GCCCTGCTGGCACGGATGGAAGTGATCCCTTATCTACCGCTGGGTCACGACACGCTAGTGCAGATCGTGG
GTGGCAAACTCAACCGACTGGTCAAGCTGCTCAAGGAGCGTTTCGGTGCCGAGGTAGTGCTGGAGGACGA
GGTGGCGGAGGAGATACTGCGCCGCGCCAATCGCAGCGAGAACGGGGCCCGCATGCTGGAATCCGTCATT
GACGGTGCCCTGCTGCCGCCTGTCTCCCTGCAACTGCTGCAGCGCCTCTCGGCCGGTGAGCCCATCAAGC
GGGTGCGTTTCTCTGTGAGCGAGCGCCAGTTCGTGGCCGAGGTGGAGGGCTGA