SecReT6
Protein ID: 145299408
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2462
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2626872..2627651 [-]
Producthypothetical protein
NoteTssL
UniProt IDA4SNM9
KEGG IDasa:ASA_2462
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-68, Aligned region: 38..243
Protein Sequence: 259 a.a.     [Download]
>gi|145299408|ref|YP_001142249.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MTTDIIKNEQLSDLLFDHAEQLDMDSDYWFRLRGQSINPMIDAVTPLLGLVQRVRLLSSYDRVPELYQRV
VTEIQAIEQELMAQGYENGVVLSFRYILCTFIDEAVMGRDWGSQSEWSEHSLLTRFHNETWGGEKVFVLL
ARLQEDPVRYRDILEFIYLCLCLGFEGRYKVMSKGRDEFERIVKQLHKQLAPETSGEAPSVFHLDLGRQA
SRYRLRKQISLRSLFMGGALILAIIFGLYHHQLNNQTQDVLRQLGELLK
 
Nucleotide Sequence: 780 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2627651-2626872 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGACCACGGACATTATCAAGAACGAGCAACTCAGCGATCTGCTGTTCGATCATGCCGAGCAGCTGGACA
TGGACTCGGACTACTGGTTCCGCCTGCGCGGCCAGAGCATCAACCCCATGATTGATGCGGTGACCCCCTT
GCTGGGGCTGGTACAGCGGGTGCGCCTGCTGTCGAGCTACGACCGGGTGCCGGAGCTCTATCAGCGGGTG
GTGACCGAGATCCAGGCCATAGAGCAGGAGCTGATGGCTCAGGGTTACGAGAACGGTGTGGTGTTGTCGT
TTCGCTACATCCTCTGCACCTTCATCGACGAGGCCGTCATGGGTCGCGACTGGGGTAGCCAGAGCGAATG
GTCGGAACACTCCTTGCTGACCCGTTTCCACAACGAGACCTGGGGCGGGGAGAAGGTGTTCGTGCTGCTC
GCCCGTCTGCAGGAAGACCCGGTGCGTTATCGCGACATCCTGGAGTTCATCTATCTGTGCCTGTGTCTCG
GTTTCGAGGGGCGCTACAAGGTGATGAGCAAGGGGCGGGACGAGTTCGAGCGTATCGTCAAACAGTTGCA
CAAGCAGCTGGCCCCCGAGACAAGCGGTGAAGCCCCCAGCGTCTTTCACCTCGACCTCGGTCGTCAGGCT
TCCCGTTACAGACTGCGCAAGCAGATTTCCCTGCGCAGCCTGTTCATGGGAGGCGCGCTGATCCTGGCCA
TTATCTTTGGTCTCTATCATCACCAACTCAATAACCAGACCCAGGACGTACTGCGTCAACTGGGCGAATT
ATTAAAATAA