SecReT6
Protein ID: 145299409
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2463
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2627675..2629009 [-]
Producthypothetical protein
NoteTssK
UniProt IDA4SNN0
KEGG IDasa:ASA_2463
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-160, Aligned region: 19..442
Protein Sequence: 444 a.a.     [Download]
>gi|145299409|ref|YP_001142250.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MSSRNRVIWREGLFIKPQHFQQQQRHSEYALHARLSALSDYFYGLQSLAINEDYLGFGRIALVGATGILP
DGTVFNIPNDDVLPAPLEITDASVANQKVYLALPLSVNGVNEVNQGGQVATRLQAHRHDVRDLHSEGGDV
VSLEVGRVSLRLMLEREDRSAYASLAIARILDKRPDGGLVLDPNFMPCSISVSAIPTLKRFLGESAGLVA
ERARSLSQRIAAPGQQGVADVAEFMMLQLLNRAQPQLSHLARLGTLHPERLHEALVQICGELMTFTDESR
LPPEFPAYRHDDQQVSFEPVMLALRQALSTVLSPRAVSIQLRKHQYGVMVAMVNESELMQSADFVLAVRA
RMPQEQLRKQLLQQTKVASSDKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQMLAVS
NTLAFHIAGDFPELDMQLWAIRSQ
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2629009-2627675 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGTCGAGTCGAAATCGGGTTATCTGGCGTGAGGGGCTCTTCATCAAGCCCCAGCACTTCCAGCAACAAC
AAAGACATTCAGAGTATGCGCTGCACGCCAGACTGAGTGCGCTCAGCGACTATTTCTATGGCTTGCAGTC
GCTGGCCATCAACGAGGACTACCTGGGGTTTGGCCGTATCGCCCTGGTAGGTGCCACCGGCATACTGCCC
GATGGCACCGTCTTCAATATTCCCAATGACGATGTGCTGCCGGCGCCCCTGGAAATTACCGACGCTTCGG
TCGCCAACCAGAAGGTTTACCTGGCATTGCCGCTCTCGGTGAACGGGGTCAACGAAGTCAATCAGGGCGG
TCAGGTCGCGACCCGCTTGCAGGCCCATCGCCACGATGTGCGCGATCTGCACAGCGAAGGAGGAGATGTT
GTCTCCCTGGAAGTGGGGCGAGTCAGCCTGCGGCTGATGCTGGAGCGCGAAGATCGCAGCGCCTACGCCT
CGCTCGCCATCGCTCGCATTCTGGACAAGCGTCCGGACGGTGGTCTGGTGCTGGATCCCAACTTCATGCC
CTGCAGCATCAGCGTCTCTGCCATTCCAACCCTCAAGCGCTTCCTCGGCGAGTCGGCCGGGCTGGTGGCC
GAGCGGGCTCGCAGCCTCTCCCAGCGTATCGCCGCGCCGGGTCAGCAGGGGGTCGCCGATGTGGCCGAGT
TCATGATGTTGCAACTGCTCAACCGCGCTCAGCCCCAGCTTTCACATCTGGCGCGTCTTGGCACCCTGCA
TCCGGAACGGTTGCACGAGGCCCTGGTGCAGATCTGTGGCGAGCTGATGACCTTCACCGATGAGTCCCGT
CTGCCGCCCGAGTTTCCTGCCTATCGTCACGACGATCAGCAGGTGAGTTTCGAGCCTGTGATGCTGGCCC
TGCGTCAGGCACTGAGCACAGTGCTGTCGCCGCGGGCTGTCTCCATCCAGCTGCGCAAGCACCAGTACGG
CGTCATGGTGGCCATGGTCAACGAGAGCGAGCTGATGCAAAGCGCCGACTTCGTGCTGGCGGTGCGTGCC
CGCATGCCCCAGGAGCAGCTGCGCAAGCAACTGCTGCAACAGACCAAGGTGGCGTCCAGCGACAAGATCC
GCGAGCTCATCAGCCTGCAACTGCCCGGCATTCCGTTGTTGCCGCTGCCGGTGGCGCCGCGCCAGCTGCC
CTATCACGCCGGTTACAGCTACTTCCAGCTCGATCGGCAAAGCCCGGCCTGGCAGATGCTGGCGGTCAGC
AACACGCTCGCCTTCCACATTGCCGGTGATTTCCCCGAGCTCGACATGCAGCTTTGGGCCATTCGCAGCC
AGTGA