SecReT6
Protein ID: 145299410
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2464
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2629012..2629527 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA4SNN1
KEGG IDasa:ASA_2464
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.00E-39, Aligned region: 11..162
Protein Sequence: 171 a.a.     [Download]
>gi|145299410|ref|YP_001142251.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MIRALMLGACLLALAGCTTMGKMADVAMDPDIQVGSNDEQATTLGLSLLAERDVNPNESGEAAPIEFQVV
LLAEDSKLLATDYDQVTEDVEKALGKNYLDHQDYTLLPGQFKYLPPIKLDEKTRYIGVIARYADPDSAEW
RKVIKVKSMGRAYQILVHLRLDEVELQKEEE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2629527-2629012 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGATACGTGCGCTGATGCTGGGGGCCTGTCTGCTGGCCCTGGCAGGCTGTACCACCATGGGCAAGATGG
CCGATGTGGCCATGGACCCGGATATCCAGGTGGGCAGCAATGATGAACAAGCCACCACCCTGGGGCTGAG
CCTGCTGGCCGAGCGGGATGTCAATCCCAACGAGAGCGGGGAGGCGGCACCCATCGAGTTCCAGGTGGTG
TTGCTGGCCGAAGACTCCAAGCTGCTTGCCACTGATTACGACCAGGTGACCGAGGATGTGGAGAAGGCCC
TTGGCAAGAACTACCTGGATCATCAGGACTACACACTGCTGCCGGGCCAGTTCAAGTATCTGCCGCCCAT
CAAGCTCGATGAGAAGACCCGCTACATCGGCGTGATTGCCCGTTATGCCGATCCGGACAGCGCCGAGTGG
CGCAAGGTCATCAAGGTGAAGAGCATGGGGCGAGCCTATCAAATCCTGGTTCATCTGCGTCTGGATGAAG
TAGAACTGCAAAAAGAAGAAGAATAA