SecReT6
Protein ID: 145299411
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2465
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2629527..2630750 [-]
Producthypothetical protein
NoteFha
UniProt IDA4SNN2
KEGG IDasa:ASA_2465
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.10E-06, Aligned region: 34..101
Protein Sequence: 407 a.a.     [Download]
>gi|145299411|ref|YP_001142252.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MDDFNQQLSLVVLNSEQLDGSQQVQYRFDEMGGTLGASEQDDWQLRDRLGSVMPAHARIELNDGRFCLCD
LSGQTYINGATSPIGRARKVHLEQGDELIVGPFRMRAYLGAISPEQNLHQVLGNRPSEQLDEWLAGEETS
QAMEDPRALAVALQHERSVLTPLVDPRQPSPLRSQPDMDAVSLAPFSAVENTMNQEFLDMPTIENHPDYH
PPLEGVDHVALTPLMRGLGQSLQLQDTQQAHDMLEEMGKTVRAMVEGLLQLQTEQAALADKHLRPIEDNP
LRLGLDYDETLAVMFAEQKSPVHLTAPAAVAESLRNVRIHHVANQQAIGAALDSILQAFSPEALIGRFEH
YRRTGAPGVADEGWAWNMYQHYYRELTSARQQGFDKLFHQVYAQAYDQAVRQQQGLI
 
Nucleotide Sequence: 1224 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2630750-2629527 Aeromonas salmonicida subsp. salmonicida A449, complete genome
GTGGACGATTTTAATCAGCAACTTTCCCTGGTGGTGCTCAACAGCGAACAGCTCGATGGCAGCCAGCAGG
TGCAGTACCGCTTCGACGAGATGGGGGGCACTCTGGGTGCCTCAGAGCAGGATGATTGGCAATTGCGTGA
CAGGTTGGGCTCGGTCATGCCAGCCCACGCCCGGATCGAGTTGAACGATGGCCGTTTCTGCCTGTGCGAT
CTGAGCGGTCAGACCTACATCAACGGCGCGACCTCGCCCATAGGGCGGGCCCGCAAGGTACACCTTGAGC
AGGGTGACGAACTGATCGTCGGTCCGTTCCGGATGCGCGCCTATCTGGGGGCCATCTCCCCCGAGCAGAA
CTTGCATCAGGTGCTGGGCAACCGGCCCTCCGAGCAGCTCGATGAGTGGCTTGCCGGGGAGGAGACCAGT
CAAGCCATGGAGGATCCACGCGCCCTCGCCGTGGCACTGCAACATGAACGCTCGGTGCTGACCCCGCTGG
TGGATCCTCGCCAGCCGTCACCACTGCGTTCACAACCGGATATGGATGCCGTATCCCTCGCCCCTTTTTC
TGCTGTCGAGAACACCATGAACCAAGAATTTCTGGATATGCCCACCATAGAGAATCACCCCGACTACCAC
CCTCCGCTGGAGGGGGTGGATCACGTGGCGCTGACCCCCTTGATGCGCGGCCTGGGTCAGTCCCTGCAGT
TGCAGGATACCCAGCAGGCTCACGACATGCTCGAAGAGATGGGCAAAACGGTGCGCGCCATGGTGGAAGG
ACTGCTGCAGTTGCAAACCGAACAGGCGGCGCTGGCAGACAAGCACCTGCGTCCCATCGAAGACAACCCG
CTGCGCCTTGGCCTCGACTATGACGAGACCCTGGCGGTGATGTTTGCCGAGCAGAAGAGTCCGGTGCACC
TGACGGCACCGGCGGCCGTGGCCGAGAGCCTGCGCAATGTGCGCATTCATCATGTGGCGAACCAGCAGGC
CATTGGCGCGGCGCTGGACAGCATATTGCAAGCCTTCTCGCCAGAGGCACTGATTGGCCGTTTCGAGCAC
TACCGCCGTACCGGCGCCCCCGGTGTAGCCGACGAAGGCTGGGCCTGGAACATGTACCAGCACTACTACC
GCGAGCTCACTTCTGCCCGTCAGCAGGGGTTCGACAAGCTGTTCCATCAGGTCTATGCCCAGGCATACGA
CCAAGCCGTGCGTCAGCAACAGGGACTGATTTGA