SecReT6
Protein ID: 145299412
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2466
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2630791..2631795 [-]
Producthypothetical protein
NoteTssG
UniProt IDA4SNN3
KEGG IDasa:ASA_2466
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.90E-95, Aligned region: 16..321
Protein Sequence: 334 a.a.     [Download]
>gi|145299412|ref|YP_001142253.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MASPDRSALPDVTSTRDAPRFNFFQLVELLNRLDGADQERGLDHLPSDENIRFKATASLGFPTSDVLQVG
RDGKGRHELEVAFLGLHGSQSPMPGYYLDSLAWEYAQGEQKLGLFLDFFHHRLLTLLHRIWRKYRYHVRF
QDNGEDGFSRLMFALVGLGNDAVCQSLPVNRAKMLSYAGMLASPSPSRSPEVVAGLVAHCFDLADVEVSA
WQWRKVPIHQDQQNRLGGACATLGGDFVIGDKVNDCAGKFLLKINDLSFGQFLGFLPNGEHFHALVTFVS
FILRDQLAWDLRLGFGQEQARGLRLGEEQSARLGWSTFLGQPPSDPFVTICVQE
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2631795-2630791 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGGCCAGTCCAGATCGGTCAGCACTCCCTGATGTGACCTCCACCAGGGACGCGCCCCGTTTCAATTTCT
TCCAGCTGGTTGAACTGCTCAACCGGCTGGACGGTGCCGATCAGGAGCGCGGCCTCGACCATTTGCCGAG
TGACGAAAATATCCGCTTCAAGGCGACCGCGTCTCTGGGTTTTCCCACCAGTGATGTATTGCAGGTGGGT
CGCGATGGCAAGGGTCGCCATGAGCTTGAAGTGGCGTTTCTGGGTTTGCACGGCAGCCAGTCACCCATGC
CAGGTTATTACCTGGATTCGTTGGCGTGGGAGTACGCGCAAGGGGAGCAGAAGCTAGGGTTGTTTCTGGA
CTTCTTTCACCACCGCCTGCTGACGCTGCTGCACAGGATCTGGCGCAAGTATCGCTATCACGTGCGCTTT
CAGGACAACGGCGAGGATGGTTTCTCCCGCCTGATGTTTGCCCTGGTGGGGCTGGGCAATGATGCCGTCT
GCCAGAGCCTGCCGGTCAATCGCGCCAAGATGCTCTCTTATGCAGGCATGTTGGCCAGCCCCAGCCCCAG
CCGCTCGCCCGAGGTGGTGGCCGGTCTGGTGGCGCACTGTTTCGATCTGGCGGATGTGGAAGTGAGTGCC
TGGCAGTGGCGCAAGGTACCCATCCATCAGGATCAGCAAAACCGGCTGGGCGGTGCTTGCGCCACGTTGG
GCGGCGACTTCGTCATCGGTGACAAGGTGAACGATTGTGCGGGCAAGTTTTTATTGAAGATCAATGACCT
GAGTTTTGGCCAGTTTCTCGGTTTTCTCCCGAACGGGGAACACTTCCATGCGCTGGTGACCTTTGTCTCC
TTCATCCTGCGCGACCAATTGGCCTGGGATCTGCGACTCGGCTTTGGCCAGGAGCAGGCCAGGGGGTTGC
GATTGGGGGAAGAGCAGAGCGCGCGCCTGGGGTGGAGTACCTTTCTCGGCCAACCGCCGAGCGACCCGTT
TGTGACTATCTGTGTACAGGAATAA