SecReT6
Protein ID: 145299413
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2467
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2631759..2633525 [-]
Producthypothetical protein
NoteTssF
UniProt IDA4SNN4
KEGG IDasa:ASA_2467
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-201, Aligned region: 3..588
Protein Sequence: 588 a.a.     [Download]
>gi|145299413|ref|YP_001142254.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MSLEHYFRDELAFLRLQGREFADTYPELTRFLSEQNTDPDVERLLEGFAFLTGNLRAKIEDEFPELTHGL
LNMLWPNYLRPVPSMTIMQFSVIPGAIAQPALVKQGCQLDSLPIDEVTCHFQTCHDAWVYPADIRHISAQ
SGNDLSTISLDIALHAPLPLCELQLDKLRFFLGGDSYTAYELYFWLANQLSHIELEIDGKRFRQEAKALK
SVGFERDDALLPYPNNVYSGYRILQEYFCFPESFLFFELSGGDWPKQPLPVSEFKLHFCFDRPLPAELKI
RPDSFMLNCVPAINLFQHDSEPVNLNGRQAEYPLKASYRHADSFEIFSVDQVEGWVEGNLGRSRGTPRIY
QPFESFQHQIERAKHRLALYYRVRVKESVSGDGFEHNLSFVRGDETTTVELDESISVTLTCTNRSRAARL
KAGSICVPTGSSPSFATFRNLIRPTRPLRPALDGSLHWTLISNLSLNYVSLLRRDALVQVLRTYDFPALH
DKQAEQASRKRLAGIEEIETKPVDRLVRGMPVRGLKSVLSIRQSAFGSEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNLDNKERYQWPVQIGQHSLM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2633525-2631759 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGTCGCTGGAACATTACTTCAGGGATGAATTGGCTTTTTTGCGCCTGCAAGGGCGCGAATTTGCCGATA
CCTATCCCGAGCTCACCCGTTTCCTGTCGGAGCAAAATACCGATCCGGATGTGGAGCGCCTGCTGGAAGG
CTTCGCGTTTCTCACCGGCAATCTGCGCGCCAAGATCGAGGATGAGTTTCCCGAGCTGACCCATGGTCTG
CTCAATATGCTCTGGCCCAACTATCTGCGCCCCGTACCCAGCATGACCATAATGCAGTTTTCGGTTATTC
CGGGTGCCATCGCTCAACCGGCGCTGGTCAAGCAGGGGTGTCAGCTCGACAGCCTGCCCATCGACGAGGT
GACCTGTCACTTTCAGACCTGTCACGATGCCTGGGTCTATCCGGCAGATATCCGCCATATCTCGGCGCAA
AGTGGTAACGATCTCTCCACCATCTCGCTGGATATTGCCCTGCATGCTCCCTTGCCGCTCTGCGAGTTGC
AGCTGGACAAGCTGCGTTTCTTCCTCGGTGGCGATAGCTATACCGCCTATGAGCTCTATTTCTGGCTCGC
CAACCAGCTCTCCCACATAGAGCTGGAGATCGATGGCAAGCGCTTTCGCCAGGAAGCCAAGGCCCTGAAA
TCGGTCGGTTTCGAGCGCGACGACGCGCTCCTGCCCTATCCGAACAATGTCTATTCCGGCTACCGGATCT
TGCAGGAGTATTTCTGCTTCCCGGAAAGCTTCCTCTTCTTTGAACTCTCGGGCGGCGACTGGCCGAAGCA
ACCCTTGCCGGTGAGCGAATTCAAGCTCCATTTCTGTTTCGACAGGCCCTTGCCTGCGGAGCTCAAGATC
CGGCCCGACTCCTTCATGCTCAACTGTGTGCCGGCCATCAACCTGTTCCAGCACGACAGTGAGCCGGTCA
ACCTCAATGGCCGTCAGGCGGAATATCCTCTCAAGGCGAGTTATCGCCATGCGGACAGTTTCGAAATCTT
CTCGGTGGATCAGGTCGAGGGCTGGGTGGAAGGCAACCTGGGTCGCTCCCGCGGTACGCCGCGTATCTAC
CAGCCGTTTGAAAGTTTTCAGCACCAGATCGAACGGGCCAAGCACAGGTTGGCACTCTATTACCGGGTGC
GGGTCAAAGAGTCGGTCAGCGGGGATGGCTTCGAGCACAACCTCTCGTTTGTACGCGGGGATGAGACCAC
CACGGTCGAGCTGGACGAATCCATTTCGGTCACGCTGACGTGCACCAACCGCTCCCGAGCTGCCCGTCTC
AAGGCTGGCAGCATTTGTGTGCCCACCGGCAGCTCGCCTTCCTTTGCCACCTTTCGCAACCTGATCCGGC
CGACCCGGCCGCTGCGTCCGGCGCTGGATGGCAGTCTGCACTGGACCCTCATCTCCAATCTGTCGCTCAA
CTATGTCTCTCTGCTGCGTCGGGATGCCCTGGTGCAAGTGCTGCGCACCTATGACTTCCCCGCACTCCAT
GACAAGCAGGCAGAACAGGCATCGCGCAAGCGACTGGCGGGGATTGAGGAGATCGAGACCAAACCGGTGG
ACAGGCTGGTGCGCGGCATGCCGGTGCGCGGGCTCAAGTCGGTACTCTCCATTCGCCAATCCGCCTTTGG
CAGCGAAGGGGAGCTTTATCTCTTCAGCACCGTGCTGGCTCACTTTTTCTCCCTGTATGCCAGCGTCAAT
GCCTTCCACCTGCTGGAGGTGGTCAATCTCGACAACAAGGAGCGCTATCAATGGCCAGTCCAGATCGGTC
AGCACTCCCTGATGTGA