SecReT6
Protein ID: 145299414
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2468
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2633529..2633960 [-]
Producthypothetical protein
NoteTssE
UniProt IDA4SNN5
KEGG IDasa:ASA_2468
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.40E-21, Aligned region: 32..123
Protein Sequence: 143 a.a.     [Download]
>gi|145299414|ref|YP_001142255.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MPYLSSWDRGNAASLFDRIRGEGLSSSPCSEVDELVDSVKRQLDQILNTRPGNCRSAPDLGVIDLNDATQ
GSADIKGRIREAIRQCIRRYEPRIIHVDVPSPDYQASPLEMSFQVTAHVRLEHIEQVTSFNVHMDSHRHY
RMV
 
Nucleotide Sequence: 432 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2633960-2633529 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGCCGTATCTCTCTTCCTGGGATAGAGGAAATGCGGCCAGTCTGTTTGATCGTATCCGGGGGGAGGGGC
TGAGCTCTTCCCCCTGTTCGGAAGTTGATGAACTGGTCGATTCTGTCAAACGGCAGCTTGACCAGATTCT
CAATACCCGTCCCGGTAATTGCCGCAGTGCCCCTGATCTTGGCGTCATCGATCTCAATGATGCTACTCAG
GGCAGTGCGGATATCAAGGGGCGGATCCGTGAGGCGATCCGGCAGTGCATCCGTCGTTATGAACCTCGGA
TCATTCATGTGGATGTACCGTCACCCGACTATCAGGCGAGTCCGCTTGAGATGTCGTTTCAGGTGACGGC
CCACGTGAGGCTGGAGCATATCGAGCAGGTCACCTCGTTCAACGTCCATATGGACAGTCACCGTCACTAC
CGCATGGTCTGA