SecReT6
Protein ID: 145299415
SecReT6 ID199
T6SS typei1
Gene symbol-
Locus tagASA_2470
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconchromosome [GenBank: NC_009348] [Browse all T6SS(s) in this replicon]
Location [Strand]2635484..2635987 [-]
Producthypothetical protein
NoteTssB
UniProt IDA4SNN6
KEGG IDasa:ASA_2470
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-58, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|145299415|ref|YP_001142256.1| unnamed protein product [Aeromonas salmonicida subsp. salmonicida A449]
MGKGIDGATVAPKERINIKYVPATGGQQAEIELPLTMMVVGNMKGRTEETPIEERQTVSIDKNNFSSVMK
ESALELKFSVPNRLEENSQDEMPVSIKIQSLEDFTPDSVAQQVPELRKLLELREALVALKGPLGNIPSFR
NRLQDLLSSDEAREQLLKELDLIKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|145297124|ref|NC_009348.1|:c2635987-2635484 Aeromonas salmonicida subsp. salmonicida A449, complete genome
ATGGGAAAAGGAATTGATGGTGCCACTGTTGCGCCCAAAGAACGTATCAATATCAAATATGTACCGGCAA
CGGGTGGTCAGCAGGCGGAAATAGAGCTTCCGTTGACCATGATGGTCGTCGGAAATATGAAGGGGCGTAC
TGAAGAAACGCCTATCGAGGAACGTCAGACCGTCTCCATCGACAAGAATAATTTCTCTTCTGTCATGAAA
GAATCCGCACTGGAACTGAAGTTTTCCGTTCCCAATCGCCTGGAGGAGAACAGCCAGGACGAGATGCCGG
TTTCGATCAAGATCCAGTCTCTGGAAGACTTCACACCTGACAGCGTGGCCCAGCAGGTACCCGAGCTGCG
CAAGCTGCTGGAACTGCGTGAGGCCTTGGTTGCCCTGAAGGGACCGCTGGGAAATATTCCCTCCTTCCGC
AATCGTTTGCAGGACCTGCTGTCCAGTGATGAGGCTCGTGAGCAACTGCTCAAGGAGCTGGATTTGATTA
AGCCTGCCGAGTGA