SecReT6
Protein ID: 145597508
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0192
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]210770..211288 [-]
Producthypothetical protein
NoteTssD
UniProt IDA4TH49
KEGG IDypp:YPDSF_0192
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.00E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|145597508|ref|YP_001161584.1| hypothetical protein YPDSF_0192 [Yersinia pestis Pestoides F]
MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFEHIVTVPTDPQSGQPSGQRAHKPLRF
TVAYNKAVPLLYNALASGEMLPTVELKWYRTSIEGKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQ
LVRVSLAYRKINWDHTTAGTSGADDWRAPIEA
 
Nucleotide Sequence: 519 bp     [Download]
>ref|NC_009381.1|:c211288-210770 hypothetical protein YPDSF_0192 [Yersinia pestis Pestoides F]
ATGCCAACTCCAGCTTATATCTCTATCACAGGGAAAACGCAGGGCAATATTACCGCAGGTGCTTTCACAG
CTGAATCCGTCGGTAATATCTATGTTCAAGGTCATGAAGACGAAATGTTGGTACAGGAGTTTGAGCACAT
TGTGACGGTGCCTACCGATCCTCAATCCGGCCAGCCTTCCGGCCAACGTGCGCACAAACCATTGCGTTTC
ACTGTTGCGTACAACAAAGCCGTTCCATTGCTGTATAACGCATTAGCCTCTGGTGAAATGCTGCCAACAG
TGGAATTGAAGTGGTACCGCACCTCGATTGAAGGCAAACAAGAGCATTTCTTCACGACTAAACTGGAAGA
TGCCACCATTATCGACATTGATTGTAAAATGCCGCATTGTCAGGATTCCACCAAGGCTGAGTTTACTCAA
TTAGTCCGTGTATCACTGGCATACCGCAAGATTAACTGGGATCACACCACCGCGGGCACCTCTGGTGCTG
ATGACTGGCGTGCGCCGATCGAAGCGTAA