SecReT6
Protein ID: 145597510
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0194
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]212377..213858 [+]
Producthypothetical protein
NoteTssC
UniProt IDA4TH51
KEGG IDypp:YPDSF_0194
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-185, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|145597510|ref|YP_001161586.1| hypothetical protein YPDSF_0194 [Yersinia pestis Pestoides F]
MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVAAFISSILDTGTNEEPINKLLVDRMI
IELDKKLSAQMDEILHANEFREIESSWRSLKLLVDRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGF
YKHVYSSGYGQFGGEPTAAIIGNYAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAI
KDLKSVFEGPAHTKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAF
LLASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFELAEEGFITLTM
RKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDL
ERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRL
DKE
 
Nucleotide Sequence: 1482 bp     [Download]
>ref|NC_009381.1|:212377-213858 hypothetical protein YPDSF_0194 [Yersinia pestis Pestoides F]
ATGCCTTTACATGAAGAAAATACCGTTTTAGCGGCAGAACCTGCCAGTGCAACATTCTTGCTCGACGAAA
TCATGTCACAAACCCGTATGGCACCGGGAAACGATGGTTACGATATCGCTAAACAGGGTGTGGCCGCTTT
TATTAGCAGTATTCTGGATACCGGAACCAACGAAGAGCCGATTAACAAGCTGTTAGTTGACCGCATGATC
ATCGAACTCGACAAAAAGTTGAGTGCTCAGATGGACGAGATCCTACATGCTAACGAATTCCGTGAAATAG
AATCTTCATGGCGCTCATTGAAGCTGTTGGTGGATCGGACCGATTTCCGTGAAAACATCAAAATCAATAT
CATGCATGCAACGAAAGAAGAGTTGCTGGAAGATTTTGAGTTCTCGCCAGAAATTATTCAGTCAGGCTTC
TACAAACACGTTTATTCCTCAGGGTACGGCCAATTCGGTGGTGAACCCACTGCCGCGATCATTGGTAACT
ACGCGTTCAACAATAGCTCACCTGACATGAAGCTCTTGCAATACGTAAGTGCTGTTGGCGCGATGGCACA
TGCCCCCTTCTTATCCAGTGTGGCCCCTGATTTCTTTGGCATCAGCAGCTTCACTGAGTTACCCGCGATT
AAAGATCTGAAATCTGTATTTGAAGGGCCGGCTCACACCAAATGGCGTGCTCTGCGTGAGTCTGAAGATT
CACGTTATCTTGGTTTGACCACTCCTCGTTTCCTGTTGCGCTTACCTTACTCGACCGTTGAAAACCCCAT
TAAAAACTTCAACTACTACGAGGATGTCAGCCGGAATCACGAGCATTTCTTGTGGGGCAACACCGCATTC
CTGCTAGCGTCCTGCCTGACCGACAGCTTCGCCAAGTACCGTTGGTGCCCGAATATTATTGGGCCGCAAA
GTGGCGGCACGGTTCACGATCTCCCGGTTCATCTCTATGAAGCGATGGGGCAGATTCAGGCCAAAATCCC
AACCGAAGTTCTGATCACTGACCGTCGTGAGTTTGAACTGGCGGAAGAGGGCTTTATCACCCTGACCATG
CGTAAAGGCAGTGATAACGCCGCATTCTTCTCGGCGAATTCGGTGCAAAAACCAAAAGTCTTCCCGAATA
CCCGCGAAGGGAAAATGGCAGAAACCAACTACAAGTTGGGCACGCAACTGCCGTACATGTTTATCATCAA
CCGCCTTGCGCACTACATCAAAGTGCTCCAGCGCGAGCAGATTGGTTCATGGAAAGAACGACAGGATCTG
GAGCGCGAGCTCAATATCTGGCTCAAGCAGTACATTGCCGATCAAGAAAACCCACCAACGGATGTTCGTA
GCCGTCGTCCTCTGCGTTCAGCGCAAATCCAGGTACTGGATGTTGAAGGTGATCCGGGCTGGTACCAGGT
TGCGATGCAGGTTCGCCCGCATTTCAAATACATGGGGGCGAGCTTCGAGCTGTCACTGGTTGGCCGTTTG
GATAAGGAATAA