SecReT6
Protein ID: 145597512
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0196
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]214305..215531 [+]
Producthypothetical protein
NoteTssF
UniProt IDA4TH53
KEGG IDypp:YPDSF_0196
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.70E-123, Aligned region: 3..354
Protein Sequence: 408 a.a.     [Download]
>gi|145597512|ref|YP_001161588.1| hypothetical protein YPDSF_0196 [Yersinia pestis Pestoides F]
MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLLEGFAFLTGNLREKIDDQFPELTHGL
LNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVKRGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCR
DVWLFPMSIREISANSSNEQGILSIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAEL
VVNGITIPMPDFDFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFS
LNLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYDIFSVDRVDSW
LSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVIMDIFYNVTL
 
Nucleotide Sequence: 1227 bp     [Download]
>ref|NC_009381.1|:214305-215531 hypothetical protein YPDSF_0196 [Yersinia pestis Pestoides F]
ATGTCGTTCGAAAAGTATTTCAGGGACGAGCTGGACTACCTCCGGCAATTAGGACGCGATGCCGCAATAG
AACGGCCTCATCTCGCTGCATTTTTATCTGAGCAAGGTTCTGATCCGGATGTTGAACGTTTGCTGGAAGG
CTTTGCTTTTCTAACGGGCAACCTGCGTGAAAAAATCGATGATCAATTCCCTGAATTGACTCATGGTTTA
CTGAATATGTTGTGGCCGAACTACTTACGGCCAATACCGAGCATGACCATCATCGAGTACACACCGGATG
AAAGTGTGGTCACCGAGGCGACGCTGGTGAAACGGGGTAGCCAAGTGATGAGTATCCCCATCGCACAAAA
TGGTCAGCGCAGCGCGTTTATCAACAGTAATGCTCATGCCGGGCCACAATGTACTTTTACGTTGTGCCGT
GATGTGTGGTTGTTCCCCATGTCCATCCGGGAGATCTCGGCGAACAGCAGTAACGAACAAGGCATTTTGA
GTATTCACTTTGCCGCCAAAGCGGAATTGAACTTACAAGACCTGCAATTGGATAAATTGCGCTTTTATCT
GGGCGAAGACAACTACACCAGCACACAACTCTATTTCTGGATTAACCACTATTTCGAACGCGCTGAACTG
GTTGTCAACGGGATAACCATCCCGATGCCTGATTTTGACTTTAACCCAGTGGGCTTTGAACGCGATGATG
CCCTCTTGCCGTACCCGAAAAACGCCTATATGGGTTACCGGATCCTGCAAGAATATTTTTGCTTCCCCGA
AGGCTTTTTGTTCTTTGATGTCAATGGTGTGGTCGATTTTCCGCCGCACTTGAATGCCAGTGAATTCTCT
CTGAATTTGTATTTCTCTCAGGCATTGCCGCCTGAAGTGAAAGTCCGCTCCACCACACTGCGGATGAATT
GCACACCTGCGGTGAACCTGTTCCAACATGACAGTGAAGCGATTGATCTTGATGGAACCCAGACGGAATA
TCCGCTCTGTGTCAGCTACCATAATCCGGATCACTACGACATCTTTTCAGTTGATCGGGTTGACAGTTGG
CTCAGTGAAAAAGGTGTTCCTAAGGGGCGCGGCCGTGCACTGAACCCCAAAACTTGGACATCTGCTTTAC
TGCTTTTCTACCTGAGTCCGGTATTCTGCCGGACTCATTCCGCCTGTTTTCAGGCTAATGCGCTCTGTAT
TGTAATAATGGATATATTCTACAATGTCACGCTTTAA