SecReT6
Protein ID: 145597515
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0199
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]216826..217569 [+]
Producthypothetical protein
NoteTssF
UniProt IDA4TH56
KEGG IDypp:YPDSF_0199
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-73, Aligned region: 4..247
Protein Sequence: 247 a.a.     [Download]
>gi|145597515|ref|YP_001161591.1| hypothetical protein YPDSF_0199 [Yersinia pestis Pestoides F]
MHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEHYISFVRSDESKLVLAEENVSVSLTC
TNRELPLSLRVGDINQLSTDSPSFATFRNITRPSVPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQIL
HTYDFPSLHNRQSARASQKKLDAIQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLAR
FFSLYASVNAFHLLKVINLDNQECYEWPVQTGQHALM
 
Nucleotide Sequence: 744 bp     [Download]
>ref|NC_009381.1|:216826-217569 hypothetical protein YPDSF_0199 [Yersinia pestis Pestoides F]
GTGCACCGGGGTCATGGCCGGGAGTACACCTCGTTTGAGAGCTTCCACCATCAGATCGAACACTCGCAAG
AAAAGACCGCACTTTATTACCGCCTACGTGTGAAAAATTCATTATTCCGTAAGGGATTCGAACACTACAT
TTCCTTTGTTCGCAGTGATGAATCGAAGCTGGTGCTTGCTGAAGAGAATGTCTCGGTCAGCCTGACGTGC
ACCAACCGTGAGTTGCCGCTGTCGTTGCGCGTTGGTGATATCAATCAACTCAGCACAGACAGCCCTTCAT
TCGCGACGTTCCGCAATATTACCCGTCCTTCCGTGCCGTTGTATCCGGTGCTGGATGGGGGCCTGCATTG
GTCATTGCTCTCCAATATGTCGTTGAACTACATGTCCTTACTGGATAAGGACGCGTTGAAGCAAATTCTG
CATACCTATGATTTCCCAAGCCTGCATAACCGGCAATCAGCCAGGGCATCGCAAAAGAAACTGGACGCTA
TCCAACGTATTGAAACACAACCGATTGACCGGTTGTTTCGTGGCTTACCTGTCAGAGGGCTACAAACCAC
GCTATGGCTGGAGCAAGGCGCTTTTAGCTCTGAAGGCGAGCTTTATCTCTTCAGCACGGTATTAGCTCGC
TTCTTCTCACTGTATGCCAGCGTCAATGCGTTTCATCTTTTAAAAGTCATCAATCTTGATAATCAGGAAT
GTTACGAATGGCCGGTACAGACAGGTCAACATGCACTGATGTAA