SecReT6
Protein ID: 145597516
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0200
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]217533..218621 [+]
Producthypothetical protein
NoteTssG
UniProt IDA4TH57
KEGG IDypp:YPDSF_0200
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-93, Aligned region: 38..348
Protein Sequence: 362 a.a.     [Download]
>gi|145597516|ref|YP_001161592.1| hypothetical protein YPDSF_0200 [Yersinia pestis Pestoides F]
MAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQLVELLNQLAVAWQGAAPVATPANEA
IRFKSTASLAFPTRDVIALDTSARGQFELEVSFLGLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFN
HRLLTLLHQIWRKYRYYICFDNGGDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEV
ICSLVSHCFNLPDITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLL
CINKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSLLGWTSILGDP
EQKPSVTIGVME
 
Nucleotide Sequence: 1089 bp     [Download]
>ref|NC_009381.1|:217533-218621 hypothetical protein YPDSF_0200 [Yersinia pestis Pestoides F]
ATGGCCGGTACAGACAGGTCAACATGCACTGATGTAAGTGTGGTTGAGGATGTAAGTGGGGTTGAGAATG
TAAATGGGGTTGAGGCAAGACCCGAAGGGCAGGCATTGGATGTTTCACGTTATAACTTTTTTCAATTGGT
CGAATTGCTCAACCAATTGGCGGTAGCGTGGCAAGGTGCGGCCCCTGTGGCGACCCCAGCCAATGAAGCC
ATCCGTTTTAAATCGACCGCCAGTTTAGCATTCCCGACCAGAGATGTGATCGCACTGGACACCTCCGCCC
GAGGTCAATTTGAGTTAGAGGTCTCTTTCCTTGGATTGCATGGCAGCCAATCGCCGCTACCAGGATATTA
CCTCGATTCGTTAGCGTGGGAGGATGCGCAGAATGAGAACCGGCTAACGGATTTCATGAACGTATTCAAC
CACCGCCTGTTAACGCTACTGCATCAGATTTGGCGTAAATACCGTTACTACATCTGCTTTGACAATGGCG
GTGATGATGCATTTTCACAACGCATGTTCTCGCTGGTGGGGTTAGGTAGCGAGGTCGTCCGCAATAAATT
GCAGATCAATCACAGCAAAATGCTGGCTTATGCAGGGCTGCTGGCCAGCCCCGGCAGAGCACCTGAAGTG
ATTTGCAGCCTTGTCTCACATTGCTTCAATTTGCCAGATATCACCTTACACAGTTGGCAGCTACGCAAAG
TGGATATTGCCCCCTCACAGCAGAATCGCTTGGGGACGAGGGTGAAAGTCCGTGGCAAGAAATATGATGA
AAAATCAGTGCTTGGCGTTAATTTCTCCATCGGTTCACGGGTTGCGGATCGTAGCGGGAAATTCTTGTTG
TGCATCAATAAGCTGACGCGAGAACAGTTCTTATCCTTTTTACCCAACGGGGCTAATTACGCCTCGTTAG
TGATGTTTGTCGCCTTCATTATGCGCGATCAATTCGCGTGGGATTTACGCCTTGGGTTGGCCGAGCAACA
GGTGGGCGGGATGGTGTTGGGAACCGAGCAAAATAGCCTATTGGGCTGGACCAGTATCCTCGGCGATCCC
GAACAGAAACCCAGCGTAACGATTGGTGTAATGGAATAA