SecReT6
Protein ID: 145597519
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0203
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]220611..221957 [+]
Producthypothetical protein
NoteTssK
UniProt IDA4TH60
KEGG IDypp:YPDSF_0203
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-155, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|145597519|ref|YP_001161595.1| hypothetical protein YPDSF_0203 [Yersinia pestis Pestoides F]
MPTKNRVIWREGLFIKPQHFQQQQRHNDYQLQRRIIALQGYSYGFSSLILNQELLKLGRIGLTVASGNMA
DGTVFDIPYQDYSPKPLDVLNCNDAASRDIYLALPMLNDAINEVAGQQGQAPGTLRYREHSDDVRDLHTE
GGDVSQLVLAQLAPRLMQGSEDLSAYSVLPLCRVKEKRPDGSLILDEEFIPTCTTLSVSTQLKGFMDEVE
GTLVERAQLLAKRIGSPGQQGIADVAEFMMLQVFNRTQPLFTHLAHQAILHPEAFYHQLVQTCGELRTFT
DESRLAGTFPVYNHDNLTDSFQPLFLAMRQALSTVLTPRAISIQLHMQAHGIRVATINDSDLLRSADFVL
AVRAQIPQEQLRRQFVQQTKITSLEKIRDLVSVQLPGVPLVALSAAPRQLPYHSGYTYFMLDLQSPVWKE
IQQSNAIAFHVSGDFPDLDMQFWAIRSS
 
Nucleotide Sequence: 1347 bp     [Download]
>ref|NC_009381.1|:220611-221957 hypothetical protein YPDSF_0203 [Yersinia pestis Pestoides F]
ATGCCAACCAAAAATCGAGTGATTTGGCGCGAAGGGCTGTTCATCAAACCGCAACATTTTCAACAACAGC
AACGGCATAACGACTACCAGTTACAACGCCGGATTATCGCTCTGCAAGGGTATAGCTATGGTTTCAGTTC
ACTGATCCTGAATCAGGAGTTATTGAAATTAGGGCGTATTGGCTTGACGGTCGCCAGTGGCAATATGGCT
GATGGCACGGTGTTTGATATCCCTTATCAAGACTATTCACCAAAGCCATTGGATGTACTGAATTGTAATG
ATGCGGCCAGCCGTGACATTTATCTGGCATTACCGATGCTAAACGATGCCATTAATGAGGTGGCAGGCCA
GCAGGGGCAAGCGCCGGGAACCCTTCGCTATCGTGAACATAGCGATGATGTCCGCGATTTACATACCGAA
GGGGGCGATGTCAGCCAGTTGGTACTGGCACAACTGGCACCGCGTTTGATGCAAGGCTCGGAAGACCTCA
GTGCTTACTCGGTCCTGCCGCTGTGTCGGGTCAAAGAGAAACGGCCTGACGGTTCGCTGATCTTGGATGA
AGAGTTCATTCCCACCTGCACCACGCTCAGTGTCTCCACGCAGTTAAAAGGCTTTATGGATGAAGTCGAA
GGGACATTGGTTGAACGCGCCCAACTACTGGCGAAACGTATTGGTTCTCCCGGTCAGCAGGGGATCGCGG
ATGTGGCTGAATTTATGATGTTGCAGGTCTTTAACCGGACACAGCCGCTCTTTACCCATTTGGCACATCA
GGCGATTCTGCATCCAGAAGCGTTTTACCATCAGTTGGTACAAACCTGCGGTGAACTGCGCACGTTTACC
GATGAATCACGCTTAGCGGGCACCTTCCCGGTTTATAACCACGATAACTTGACCGACAGTTTTCAGCCGT
TGTTTTTGGCGATGCGTCAGGCATTAAGCACCGTGCTCACACCGCGTGCCATCTCTATCCAGTTGCATAT
GCAGGCACACGGTATTCGCGTTGCGACCATTAATGATAGTGATCTATTGCGCAGTGCTGATTTTGTGCTG
GCGGTTCGGGCGCAAATACCTCAAGAACAATTGCGTCGGCAGTTTGTTCAGCAAACCAAAATCACCTCAC
TTGAGAAAATACGCGATTTGGTCAGTGTCCAACTGCCCGGCGTCCCGTTGGTGGCACTGTCCGCCGCACC
GCGCCAGCTCCCTTACCACTCGGGATACACCTACTTCATGCTGGATCTGCAAAGCCCTGTATGGAAAGAA
ATCCAGCAAAGCAATGCGATTGCCTTCCACGTCTCGGGTGATTTCCCTGATCTGGACATGCAATTCTGGG
CAATCAGGAGCAGCTAA