SecReT6
Protein ID: 145597521
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0205
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]222735..225329 [+]
ProductClp ATPase
NoteTssH
UniProt IDA4TH62
KEGG IDypp:YPDSF_0205
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.10E-39, Aligned region: 222..299
AAA_2 [PF07724], Evalue: 8.10E-39, Aligned region: 599..760
AAA [PF00004], Evalue: 6.20E-19, Aligned region: 31..72
AAA [PF00004], Evalue: 6.20E-19, Aligned region: 222..334
AAA [PF00004], Evalue: 6.20E-19, Aligned region: 537..564
AAA [PF00004], Evalue: 6.20E-19, Aligned region: 605..725
AAA_5 [PF07728], Evalue: 9.00E-15, Aligned region: 51..74
AAA_5 [PF07728], Evalue: 9.00E-15, Aligned region: 222..299
AAA_5 [PF07728], Evalue: 9.00E-15, Aligned region: 604..723
ClpB_D2-small [PF10431], Evalue: 3.50E-13, Aligned region: 766..840
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 50..50
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 254..300
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 410..480
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 488..549
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 577..645
AAA_16 [PF13191], Evalue: 1.30E-11, Aligned region: 670..698
AAA_22 [PF13401], Evalue: 2.60E-08, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 2.60E-08, Aligned region: 602..635
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 133..168
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 222..250
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 419..454
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 605..633
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 809..834
AAA_14 [PF13173], Evalue: 4.30E-05, Aligned region: 222..337
AAA_14 [PF13173], Evalue: 4.30E-05, Aligned region: 603..693
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 601..629
DUF258 [PF03193], Evalue: 0.00013, Aligned region: 188..239
DUF258 [PF03193], Evalue: 0.00013, Aligned region: 603..620
AAA_19 [PF13245], Evalue: 0.00027, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00027, Aligned region: 598..626
AAA_25 [PF13481], Evalue: 0.00028, Aligned region: 222..244
AAA_25 [PF13481], Evalue: 0.00028, Aligned region: 476..501
AAA_25 [PF13481], Evalue: 0.00028, Aligned region: 599..633
Arch_ATPase [PF01637], Evalue: 0.00098, Aligned region: 202..241
Arch_ATPase [PF01637], Evalue: 0.00098, Aligned region: 604..625
Arch_ATPase [PF01637], Evalue: 0.00098, Aligned region: 675..686
IstB_IS21 [PF01695], Evalue: 0.0015, Aligned region: 216..246
IstB_IS21 [PF01695], Evalue: 0.0015, Aligned region: 603..615
Sigma54_activat [PF00158], Evalue: 0.0041, Aligned region: 221..238
Sigma54_activat [PF00158], Evalue: 0.0041, Aligned region: 603..702
MobB [PF03205], Evalue: 0.0054, Aligned region: 222..246
MobB [PF03205], Evalue: 0.0054, Aligned region: 604..626
AAA_17 [PF13207], Evalue: 0.0063, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0063, Aligned region: 605..639
Protein Sequence: 864 a.a.     [Download]
>gi|145597521|ref|YP_001161597.1| Clp ATPase [Yersinia pestis Pestoides F]
MIQIDLPTLVNRLNPIARHSLEAAAAHCVSQQEAEITVSQVLLQMISTPLCDVRLILSHAGVEEDELRES
LDQRVSGYQAITQAYPSFSPLLVEWLQDSWLLASTEMEHSQLRSGVMLLTLLLSPSRYLVPTANRLLSPI
NRELLRQNFANWTADSAETPRAEKGAEAGNGAEINGDSLLARYASNMTEQARNGELDPVLCRDTEIDLMI
DILCRRRKNNPIVVGEAGVGKSALIEGLALRIVDNQVPEKLRNSELMTLDLGALQAGAAVKGEFEKRFKG
IMAEIAQSTTPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPSAQEATIIMRGLRTVYEQAHGVLIDDEALQAAAVLSDRYISGRQLPDKAIDVLDTAAARV
AINLTSAPRQVSALKNELYHQGMEIEMLEREQRLSLSRPDERLSVLQQQRIEIEQQLIALNTGWEKQQHL
LQQIIALRAVLLAQEESATDEQVVNLTALSDELERLQQHQTLVSPHVDKSQIAAVIAEWTGVPLNRLSQS
ELAVVTELPSYLGQQIKGQETAIHCLHQHLLTARADLRRPMGAFLLVGPSGVGKTETVLQIADLLYGGRQ
YLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKG
ELADGEGRIIDCKNIVFFLTSNLGYQTIVDHADEPALLNERLYPELSAFFKPALLARMEVVPYLPLGMET
LQIIIHGKLNRLDTLLRQRFSADVVIEPEVIDEILLRATRAENGARMLESIIDGALLPPVSLLLLQKVAA
GTAISHIRIAVEGNVFTAQVEGAI
 
Nucleotide Sequence: 2595 bp     [Download]
>ref|NC_009381.1|:222735-225329 Clp ATPase [Yersinia pestis Pestoides F]
ATGATTCAAATTGACTTGCCCACACTCGTAAACCGCCTTAATCCCATTGCCCGCCATTCTCTGGAAGCGG
CGGCGGCGCATTGCGTCAGTCAGCAGGAAGCTGAAATTACGGTCTCCCAAGTGCTACTGCAAATGATCTC
CACACCATTATGTGATGTCAGGTTAATCCTGAGCCATGCGGGTGTTGAGGAGGATGAACTACGGGAGTCG
CTCGATCAACGTGTTTCAGGCTATCAAGCTATTACCCAGGCCTACCCGAGTTTTTCCCCATTACTGGTGG
AATGGTTACAAGACAGTTGGTTGCTGGCATCGACAGAGATGGAACACAGCCAACTCCGTAGCGGCGTGAT
GTTATTGACGTTGTTGCTCAGCCCGTCGCGCTATCTGGTCCCCACGGCCAACCGGCTACTGTCTCCGATT
AACCGTGAGTTACTGCGTCAGAATTTTGCTAACTGGACGGCAGACTCAGCAGAAACACCGCGAGCAGAAA
AAGGGGCTGAAGCTGGCAACGGCGCAGAAATCAATGGTGACAGCTTGCTGGCCCGCTATGCCAGCAATAT
GACCGAACAGGCCCGTAACGGGGAATTAGACCCTGTGCTGTGTCGGGATACCGAAATCGATCTGATGATC
GATATTCTGTGCCGCCGCCGCAAAAATAACCCGATAGTGGTGGGTGAAGCGGGGGTAGGGAAAAGTGCGC
TGATCGAAGGTTTAGCCCTGCGTATCGTGGATAATCAGGTGCCAGAAAAACTGCGTAACAGCGAGTTGAT
GACGCTGGATTTAGGCGCGCTTCAGGCTGGCGCGGCAGTGAAAGGCGAATTTGAGAAGCGTTTCAAGGGC
ATCATGGCGGAAATTGCGCAGTCCACGACGCCAATTATCCTGTTTATTGATGAAGCACACACGCTGATCG
GGGCCGGTAACCAACAGGGCGGGTTAGACATTTCCAATCTGCTCAAACCCGCTTTAGCGCGTGGTGAACT
GAAAACGATTGCGGCAACCACCTGGAGCGAATACAAAAAATACTTTGAAAAAGATGCTGCGCTGTCGCGC
CGTTTCCAGTTGGTCAAAGTTTCTGAACCCAGCGCGCAAGAGGCCACGATTATCATGCGTGGCCTACGTA
CAGTTTATGAACAGGCGCATGGCGTCCTGATCGATGATGAAGCATTGCAAGCTGCGGCGGTGCTCAGTGA
CCGCTATATTTCAGGGCGGCAGTTGCCAGATAAAGCCATCGACGTGTTAGATACCGCAGCCGCACGTGTT
GCCATCAATCTCACCTCTGCACCGCGTCAGGTTTCGGCACTGAAAAACGAACTCTACCATCAGGGGATGG
AAATCGAGATGCTGGAGCGGGAGCAACGCCTCAGCTTAAGCCGCCCGGATGAGCGGTTATCCGTTTTACA
ACAGCAGCGAATTGAGATCGAACAGCAACTCATTGCCCTGAATACCGGTTGGGAAAAGCAACAACATTTG
CTCCAGCAGATTATCGCACTGAGAGCGGTCCTGTTGGCACAAGAAGAGAGCGCCACAGATGAGCAAGTGG
TCAATCTGACAGCGTTGAGCGATGAGTTGGAACGGTTGCAACAGCACCAGACGCTGGTCTCGCCCCATGT
GGATAAGAGCCAGATTGCGGCGGTGATCGCGGAATGGACCGGTGTACCGCTAAACCGCCTTTCTCAGAGT
GAATTGGCGGTGGTTACTGAATTGCCCTCTTATCTGGGGCAGCAGATCAAAGGACAAGAGACGGCTATCC
ATTGCTTGCACCAACACTTGCTGACCGCAAGGGCGGATTTACGTCGCCCAATGGGGGCTTTCCTGTTGGT
TGGGCCTAGCGGCGTGGGTAAAACGGAAACCGTGCTACAGATTGCCGACCTGCTCTATGGTGGCCGCCAA
TATCTCACCACCATCAATATGTCCGAATTCCAAGAGAAGCATACCGTCTCGCGCCTGATTGGTTCACCTC
CGGGCTACGTCGGGTATGGTGAAGGCGGCGTACTGACCGAAGCCATTCGCCAAAAACCTTACTCGGTAGT
GCTACTGGATGAAGTGGAAAAAGCCCACCCCGATGTGCTGAATCTGTTTTATCAGGCCTTCGATAAGGGC
GAGTTGGCGGACGGTGAAGGCCGCATCATCGATTGCAAAAATATCGTATTTTTCCTGACCTCCAATCTGG
GATACCAGACCATTGTTGATCATGCAGACGAGCCTGCATTGCTCAATGAACGGCTCTACCCCGAGCTATC
GGCATTCTTTAAACCTGCGCTACTGGCCCGCATGGAAGTGGTTCCTTATCTGCCGCTGGGCATGGAAACG
CTGCAAATTATCATTCACGGCAAACTGAACCGTCTGGATACGCTGCTGCGCCAACGCTTTAGTGCTGATG
TGGTCATTGAACCTGAAGTGATCGACGAAATCCTGCTACGCGCGACCCGTGCCGAAAATGGTGCGCGTAT
GCTCGAGTCGATTATCGACGGTGCGCTATTACCACCGGTTTCTCTGTTGTTATTACAGAAAGTGGCCGCT
GGCACCGCTATCAGCCACATTCGGATCGCGGTAGAGGGGAATGTGTTTACTGCACAGGTTGAGGGAGCGA
TATGA