SecReT6
Protein ID: 145597526
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0210
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]231890..232672 [+]
Producthypothetical protein
NoteTssA
UniProt IDA4TH67
KEGG IDypp:YPDSF_0210
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.30E-22, Aligned region: 41..101
Protein Sequence: 260 a.a.     [Download]
>gi|145597526|ref|YP_001161602.1| hypothetical protein YPDSF_0210 [Yersinia pestis Pestoides F]
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDLQTAVYYTLAR
TQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERAL
QLLYDKLQPVELKRVPRIENLLYLMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAAA
PEPAANIEVRSPPRRLNGGRCCGALVPVSCVVYWWRLRFTLPSSNRCNSK
 
Nucleotide Sequence: 783 bp     [Download]
>ref|NC_009381.1|:231890-232672 hypothetical protein YPDSF_0210 [Yersinia pestis Pestoides F]
ATGAGTGACACCCCGCAACATATCATCATTAAAACCGGCACTGACCCACGGAACCGGCCGGAATTTAACG
CCATTCGTGAAGAGATCAACAAAATCAACCACCCGGCACGGCCAGAGGTCAACTGGGGTTTGATTGAATC
ACTGGCGCTGACCCTGTTCCGCACCCACGGCGTGGATTTGCAGACGGCGGTGTATTACACGCTGGCCCGC
ACCCAAAAAAATGGCCTGGCCGGTTTCACCGAGGGCTGCGAGTTGCTGGCCGGTATGGTAGTCGGCCAGT
GGGATCACCTGTGGCCGGAACAGCCGCAGGCACGCAGTGAAATACTGGAATGGTTCAATACCCGCGTCAG
CAATCAACTGCGTCAGCATGATTTTACCCGTGACGATCTGCGGCTGGTGTACCGCGCCGAGCGGGCCTTG
CAGTTGCTGTACGATAAATTGCAACCGGTTGAATTAAAACGGGTACCGCGCATTGAAAACTTGCTGTACC
TGATGCAGAACACCGCCAAAAAACTCGAATCGGCCAGTGATGCGGCGAAGGCTCAGCAAACCGCGGCCCC
GCTGAAAATGCCGCCTATGGTCTATCTCTCGGTACCCGAGGCCGAGCCTGTCCGGACGGCAGCGGCAGCC
CCTGAGCCTGCGGCCAATATTGAGGTGCGTTCGCCCCCCCGGCGACTAAACGGGGGGCGGTGCTGTGGGG
CTTTGGTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGTTCAAACCGCTG
CAACAGCAAATGA