SecReT6
Protein ID: 145597527
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0211
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]232579..233202 [+]
Producthypothetical protein
NoteTssA
UniProt IDA4TH68
KEGG IDypp:YPDSF_0211
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.10E-48, Aligned region: 24..39
DUF3702 [PF12486], Evalue: 2.10E-48, Aligned region: 54..201
Protein Sequence: 207 a.a.     [Download]
>gi|145597527|ref|YP_001161603.1| hypothetical protein YPDSF_0211 [Yersinia pestis Pestoides F]
MLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPDVATYGEQLSTLENLSPLFVL
NTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDSSYFQLQQRLHALSEKLLEQERSRGSLTI
SYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWNALLSRYHHLTQQTNSAR
 
Nucleotide Sequence: 624 bp     [Download]
>ref|NC_009381.1|:232579-233202 hypothetical protein YPDSF_0211 [Yersinia pestis Pestoides F]
GTGCTGTGGGGCTTTGGTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGT
TCAAACCGCTGCAACAGCAAATGACGGTGCTGGCCACCCAACCGGAAAGCGCGGCATTGCTGTGGCTCAA
CCGCCCGGATGTCGCCACCTATGGTGAGCAACTGAGCACCCTGGAAAACCTCTCGCCCCTGTTTGTGCTC
AATACCGCCGACCAGTCGGTGGCGATGGCTCGTCAACGCTGGCCGTCCGATCCCAGTCAGGTGGCCGAAA
GCCAGCGCTGGGCGCGGTTGGTGGAGGCGCGTATCGGCCTGGCCGGTACCGACAGCAGCTATTTCCAGCT
CCAGCAGCGCTTGCATGCGCTGTCTGAAAAATTACTCGAACAGGAACGTTCTCGGGGCAGTCTGACCATC
TCCTATCTAAAAACAGCAGTTTACCAGATGCAGACCGAGCTGAACCGGGAGATACCGCTGGAGGAGTTAC
TGCGCCAGTTGGCGGTGTCCGCCGATGAACATCAACCGGCCTCGCCGGTCTTGATAAAACAAATTGATGA
CCGTTGGAATGCCTTACTCAGCCGTTATCACCACTTAACGCAGCAGACGAACTCTGCCCGTTAA