SecReT6
Protein ID: 145597528
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0212
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]233224..235614 [+]
ProductRhs accessory genetic element
NoteTssI
UniProt IDA4TH69
KEGG IDypp:YPDSF_0212
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 190..487
Phage_GPD [PF05954], Evalue: 1.40E-69, Aligned region: 666..697
Phage_base_V [PF04717], Evalue: 1.90E-23, Aligned region: 527..619
Protein Sequence: 796 a.a.     [Download]
>gi|145597528|ref|YP_001161604.1| Rhs accessory genetic element [Yersinia pestis Pestoides F]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALEAKAKVLDGGVT
PMNLAAGGAGAGLPDSAAAAVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVD
FAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEI
ITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTVVYADDVGSLP
KGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGELQNQRPDYEHFDFP
GRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAWQLLGIQHSGKQMQA
LEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWDRYGQ
SNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAF
RSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQSNTIQN
DRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQGDISISTPNAGITI
THDGAIVLQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2391 bp     [Download]
>ref|NC_009381.1|:233224-235614 Rhs accessory genetic element [Yersinia pestis Pestoides F]
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCAAAAACCGCCCTGGATGCC
AAAGCAAAAGTACTGGACGGCGGCGTCACGCCGACGAACATTGTGGCCACTGGCCCGGCCCCAACCGTGA
GTGGCGCTCAAATGACCGAGATGGCCGGGGGGATCGGGGATGCGGTGGGCGGTACTGCCGGTAAGCGCAT
TAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGAGGCCAAAGCAAAAGTACTGGACGGCGGCGTCACG
CCGATGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTGCCGGACAGCGCCGCGGCGGCGGTCAAACAGC
CCTCCGGCCTGCAATTTACCCTGACGACGGCCAGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCAC
CCTGAGCGAGATGCTCTCCTCGCCGTTTGTGCTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTGGAT
TTTGCGGCGGTATTGGATGAAGACGCCACGCTGTTTATCTGGCGCGAAGGGGTACTGCAACGCAGCATCA
CCGGCATGGTCGCCAGCTTTGAACAGGGCGATACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCG
CCCGGCGCTGTGGCGCACCAGCCTGCGGCGCAATGCCCGCATCTTCCAGCAAGCCTCGGTGGAAGAGATC
ATCACCACCCTGCTGAAAGAGAACGGCATCAACGATTTTGCTTTTGGTTTTCGCCACCCGCACCCGGTGC
GCGAGTTCTGCGTGCAATATCAGGAGTCCGATTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGAT
TTTCTACTACTTCGAGTTCAGCGCCGGGAAAAATACCGTGGTGTATGCCGATGATGTTGGCTCCCTGCCG
AAAGGCGCGTCACTGCCCTATAACCCGAATGTGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCA
CCCGCAGTGCGCAGGTGCGCCCGGCGATGGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGC
CGCGGCCTTCAGCGAACAGTCGGGAGAACTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCG
GGGCGCTTCAAAGATGCCCAGCACGGGCAGGATTTTACCCGCTACCGGCTGGACGCGCTGCGCAATGACG
CCAATCTGGGGCAGGGGGCCAGCAATGATTTTACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCA
CCCGCGTGGTGATCTGAACCACGCCTGGCAGTTGCTCGGTATTCAGCACAGCGGCAAACAGATGCAGGCG
CTGGAGCAGGCATCTGGCGATCAGGGCACGGTGCTGTTCAACCACTTCAGTTTTATTCCGCACACCCAGA
CCTGGCGGCCGACGCCGTTGGCTAAACCGGCGATGGACGGCCCGCAGATCGCCATGGTGGTGGGGCCGCC
GGGGGAAGAGATTTACTGCGACGAATACGGCCGCATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAG
AGCAATGACAACAGCTCCTGTTGGATCCGGGTAACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGG
CCATTCCGCGTATTGGTCAGGAAGTGGTGGTGGATTTTCTGCACGGCGATCCGGATCAACCGATTGTCAC
GGGGCGGACCTATCACGCCAACAACATCCCGCCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTC
CGCTCAAAAACCCACAAAGGGGAAGGCTACAACGAAATGCGCTTCGAGGATGCCAAAGGCGGCGAAGGGC
TGTTTATGCATGCGCAGAAAGATATGACGACCATGGTGCTGAATGATCGCAAAACCGATGTGACTCAGGA
CCATTCAGAGCACATTGGGCAAGATCAGTCCGTGACGGTTGTGCGTAACCAAAGTAATACGATCCAAAAT
GATCGCCGGGTAGAGGTGACTCGCGATCAACAAACCGAAGTGGGCAATGATTACCAGCTAGTGGTGAAAG
GTGAAAAGAAAGAGTTTGTGACGAAAATTCGTTACACCGAAGTGCATGAAGACGAAACGCTCACGGTGAC
GAAAAGTATTAAAATCCATGCCAAACAAGGTGATATCAGCATATCAACCCCGAATGCCGGAATTACGATC
ACCCATGACGGTGCCATTGTTCTGCAAGGGAAATACATTCGTTTAGCGGCCGATATGATCGATCTTAATC
CAGAGGAGTAG

Protein ID: 145597536
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0220
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]242211..244409 [+]
ProductRhs accessory genetic element
NoteTssI
UniProt IDA4TH77
KEGG IDypp:YPDSF_0220
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.80E-70, Aligned region: 134..431
Phage_base_V [PF04717], Evalue: 1.30E-23, Aligned region: 471..563
Gp5_C [PF06715], Evalue: 1.30E-05, Aligned region: 605..628
Gp5_C [PF06715], Evalue: 1.30E-05, Aligned region: 630..654
Protein Sequence: 732 a.a.     [Download]
>gi|145597536|ref|YP_001161612.1| Rhs accessory genetic element [Yersinia pestis Pestoides F]
MFAHDKANNNKTADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRLVKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPF
VLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLR
RNARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAG
KNTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGE
LQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRGDLNHAW
QLLGVQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEY
GRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNI
PPGSLPASKTQMAFRSKTHQGEGYNEMRFEDAKGGEGLFMHAQKDMSTTVKDNQTTTVEKGNQTVTVEKG
DRTVTVATGNETTDITQGSLTETIKVRRSTCANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSITLNPDS
IILQFSGSTSITLNAANIDAIAPLINLNKDKG
 
Nucleotide Sequence: 2199 bp     [Download]
>ref|NC_009381.1|:242211-244409 Rhs accessory genetic element [Yersinia pestis Pestoides F]
ATGTTTGCTCATGATAAAGCTAATAATAATAAAACCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATGGCCGGGGGGATTGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATTAATCAGGCCGCCGAGGTGGCTAAAACCGCCCTGGATGCC
AAAGCAAAAGTCCTGGACGGCGGCGTCACGCCGCTGAATCTGGCCGCGGGCGGGGCCGGTGCGGGATTAC
CGGACAGCGCCGCGGCGGCGCTTACCCGCCTGGTCAAACAGCCCTCCGGCCTGCAATTTACCCTGACGAC
GGCCAGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCACCCTGAGTGAGATGCTCTCCTCGCCGTTT
GTGCTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTGGATTTTGCGGCGGTGCTGGATGAAGACGCCA
CGCTGTTTATCTGGCGCGAAGGGGTGCTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGG
CGATACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGG
CGCAATGCCCGCATCTTCCAGCAGGCCTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCA
TCAACGATTTTGCCTTTGGTTTTCGCCACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTC
CGATTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGG
AAAAATACCGTGGTGTATGCCGATGATGTCGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGA
ATGTGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGAT
GGTGCAACTGAAGGACTACACCTTTAAAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAA
CTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGC
AGGATTTTACCCGCTACCGGCTGGATGCACTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGA
TTTTACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCACCCGCGTGGTGATCTGAACCACGCCTGG
CAGTTGCTCGGCGTTCAGCACAGCGGCAAACAGATGCAGGCGCTGGAGCAGGCGTCTGGCGATCAGGGCA
CGGTGCTGTTCAACCACTTCAGTTTTATTCCGCACACCCAGACCTGGCGGCCGACGCCGCTGGCGAAACC
GGCGATGGACGGCCCGCAGATCGCCATGGTGGTGGGGCCACCGGGGGAAGAGATTTACTGCGACGAATAC
GGGCGCATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCC
GGGTAACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGGCCATTCCGCGTATTGGTCAGGAAGTGGT
GGTGGATTTTCTGCACGGCGATCCGGATCAACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATC
CCGCCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTCCGCTCAAAAACCCACCAAGGGGAAGGCT
ACAACGAAATGCGCTTCGAGGATGCCAAAGGCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGAG
TACCACGGTAAAAGATAACCAGACGACGACGGTGGAGAAAGGTAATCAAACCGTCACCGTAGAAAAAGGT
GACAGGACAGTCACGGTCGCGACCGGAAATGAAACCACAGATATTACCCAAGGGAGCCTGACCGAGACGA
TCAAAGTGCGTCGCAGTACCTGCGCGAATTTTATTCAGGTGAAGGCTGAAGGTGATGCGCCTGGTACGCA
ACTTTATACCGCGACGGAACAGATAAAGTTCGTGGTGGGCAAGAGCAGCATTACCTTAAATCCGGACTCT
ATTATTCTGCAATTTTCTGGCTCTACCTCTATTACGCTGAATGCCGCCAATATTGACGCCATCGCGCCAT
TGATTAACTTAAATAAAGACAAGGGATAA