SecReT6
Protein ID: 145597538
SecReT6 ID200
T6SS typei1
Gene symbol-
Locus tagYPDSF_0222
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]244879..249417 [+]
Productmembrane protein
NotePAAR
UniProt IDA4TH79
KEGG IDypp:YPDSF_0222
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 439..454
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 531..552
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 573..599
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 612..637
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 624..649
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 645..682
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 699..723
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 732..769
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 776..812
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 806..834
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 840..874
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 904..923
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 930..954
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 968..980
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 989..1001
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 1062..1082
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 1128..1148
RHS_repeat [PF05593], Evalue: 3.70E-47, Aligned region: 1165..1193
PAAR_motif [PF05488], Evalue: 7.30E-16, Aligned region: 181..249
RHS [PF03527], Evalue: 2.60E-07, Aligned region: 706..723
RHS [PF03527], Evalue: 2.60E-07, Aligned region: 1181..1191
RHS [PF03527], Evalue: 2.60E-07, Aligned region: 1271..1303
DUF4595 [PF15283], Evalue: 5.10E-05, Aligned region: 432..465
DUF4595 [PF15283], Evalue: 5.10E-05, Aligned region: 453..534
DUF4595 [PF15283], Evalue: 5.10E-05, Aligned region: 572..604
DUF4595 [PF15283], Evalue: 5.10E-05, Aligned region: 613..714
DUF4595 [PF15283], Evalue: 5.10E-05, Aligned region: 814..852
DUF4595 [PF15283], Evalue: 5.10E-05, Aligned region: 926..937
DUF4595 [PF15283], Evalue: 5.10E-05, Aligned region: 1132..1170
Protein Sequence: 1512 a.a.     [Download]
>gi|145597538|ref|YP_001161614.1| membrane protein [Yersinia pestis Pestoides F]
MTVAQSIGTGYGAAGAQSALRQTALGQQSPARTDYQVSNPNVGNIARASDSLLNVAESQQFNTLVTAGFG
MQAIAAGVAGGYVGAKIGNKLGHGIARALNFNQVATEGESPAHLGHPIAHQKKDWGVWGAIGGILLGAAA
AALVVVTFGTGLVVIAAAAAAAGLIGGIAAATGAALGQYGDNKGVIAEGSANVFFEGQPVARVGDKIQCS
DHPSSPPPMIAEGAKTVFANQKQIARLGHRTTCDGNINAGCGSLAITQETAYVYEVADSRNPYLRWSAVI
LSFLPIQKKFEQGFRSLKKPPNTAVNATHNCPTGSDPVDMVSGDYLQVWPVIDIAGVLPVRLQRTYRSGD
YFTVSGCFGHKWADSWSQHLVVHEDNIDYIDEEGVGLSFFTPENKVQAVNLYNLRYELVGERHGELRVFD
RSTQQTLHFNQQQQQQRYLSAITDRKGNRIDFRYQQGELISVEHSDGYVLEIDSRGRTIHAVELVTQEKR
QKLLQSTFSERGYLVQCQSFQYGTLSHEYDPKGYMVRWRDTDSTDVAVRYDISGRVVALKTSTGFFADHF
IYHDKERYTIYRDGEGGETGYHYNENNLLIKLVDPLGNTTLTDWDLTQKIKETDALGRITRFIYNERGDL
TAVILPDETRTEYEYNPSGVVTAFTSSAGDSWQYQYDRQGLLRQVTYPSGQTMSFRYGKKGEVLRKIIAE
DQVWRYHYDHHGCLSTIIDPKGNSTAVTLDVLGRLFSHQNALGELTRYTHSDAHASPAGSVTKMVMPDGV
EQAIAYDSEKRIAALTDGAGKTTRYEYGGFDLLTGLIRPDGQRLTFGYDTLTRLNQVTNASGDTYRYTRD
RAGQVISETDFTGRTVHYQYDAVGRRIGARYPDQRLVRWHYSMQDQVLAQQTWHCDALSSTLVGTVSYGY
DGAGRLLSATNADAVVEFDYDEAGQLVAERLNGREVRHQWDALNGTPVARQVGELGLTFVYGAQGELTRL
QLAGHQPLQLQHDRLGRETVRESAAGFIQACNYTPSGLLAHQAAGRNSALFQQQLIAPESPALHGSAVNR
SWQYDRAYNVVGMDDGRWGKTQYQYDRNDQVVRADFGGFLPLQEQFSYDVNQNLREHRCLPRGAQAVLAQ
ASQQQQAGRVVKRGDSQYRYDAAGRLVEKRSQKDGYRPQLWRYRWNEQDQLSELITPTGARWRYGYDAFG
RRIRKLRVVDTPPLNEMDAPSTGPATASLAGYAYLWSGDQLIEEVPVYADGTVAYEQGIHWLYAPGGLTP
MARYAQGKLHYVVADHLGTPRELLNEQGKVVWASRLSTWGQAELWRQAANEEDRVSCNLRFAGQYADAES
GLHYNRFRYYDGETGQYLCPDPIGLEGGLNPYGYVHNPVSWVDPLGLATCPMREVNGTKIFGKGQKDGTP
GHDQFSEVIANKLAMSGKFKEVYLNRSYNFANGKGISGRRPDIMAVDMNGKVHAIELASKTDMGRKFPSL
RTRNQDAMKNLPSIDRGSVIVLEHQYNSSKIKNALDNLISGI
 
Nucleotide Sequence: 4539 bp     [Download]
>ref|NC_009381.1|:244879-249417 membrane protein [Yersinia pestis Pestoides F]
ATGACTGTCGCACAAAGTATTGGCACCGGGTATGGCGCGGCTGGCGCGCAATCGGCATTACGTCAAACCG
CGCTGGGGCAACAGAGCCCGGCGCGGACGGATTATCAGGTCAGTAATCCCAATGTGGGGAATATCGCGCG
AGCGAGTGATTCTCTGCTGAATGTGGCGGAAAGTCAGCAGTTTAACACTCTGGTGACCGCCGGTTTTGGG
ATGCAGGCGATTGCCGCCGGGGTGGCCGGGGGATATGTCGGTGCCAAAATCGGCAATAAGTTAGGTCACG
GTATTGCCCGTGCGCTTAATTTTAATCAAGTGGCGACGGAAGGAGAAAGCCCCGCGCACCTGGGCCATCC
CATTGCCCATCAGAAAAAAGATTGGGGGGTGTGGGGGGCCATTGGCGGTATTTTACTGGGGGCAGCGGCG
GCGGCATTGGTGGTCGTCACCTTTGGTACGGGGTTGGTGGTGATTGCCGCGGCGGCGGCCGCAGCCGGGT
TAATCGGCGGTATCGCCGCCGCGACCGGGGCGGCATTAGGACAATACGGTGATAACAAAGGCGTGATTGC
TGAAGGCTCCGCCAACGTCTTCTTTGAAGGCCAGCCGGTGGCCCGGGTGGGGGATAAGATCCAATGCAGC
GATCACCCCAGTTCACCGCCGCCGATGATTGCCGAGGGCGCAAAAACCGTATTTGCCAACCAAAAGCAGA
TCGCGCGTCTGGGGCACCGTACCACCTGCGATGGCAATATCAATGCGGGATGCGGTTCGCTCGCCATCAC
GCAGGAAACGGCTTATGTGTATGAAGTGGCAGACAGCCGTAATCCGTATTTACGCTGGTCAGCGGTTATT
CTGAGTTTCTTGCCAATACAGAAAAAATTTGAGCAAGGGTTTCGCTCCTTAAAAAAGCCGCCCAATACCG
CGGTCAACGCTACCCATAACTGCCCGACCGGCAGTGATCCTGTTGATATGGTCTCCGGCGATTACCTTCA
GGTCTGGCCCGTGATTGATATTGCCGGTGTTTTGCCTGTCCGGTTACAGCGTACTTATCGTTCCGGCGAT
TATTTCACGGTCTCGGGTTGCTTTGGTCATAAATGGGCGGATAGCTGGTCACAACACTTGGTCGTGCACG
AAGACAACATTGATTACATTGATGAGGAAGGGGTGGGGCTGAGCTTCTTTACGCCAGAGAATAAAGTCCA
GGCCGTCAATCTGTATAACCTGCGTTATGAGTTAGTGGGGGAGCGTCATGGCGAACTCAGGGTTTTTGAC
CGGTCAACTCAGCAGACACTGCATTTTAATCAACAGCAACAACAGCAGCGTTATTTATCGGCTATCACCG
ACCGCAAAGGGAACCGAATCGATTTTCGTTACCAACAGGGGGAACTGATATCGGTCGAGCACAGTGACGG
CTATGTGCTGGAGATCGACAGCCGTGGCAGGACAATACACGCGGTCGAGCTTGTCACGCAGGAGAAAAGA
CAAAAGCTGTTGCAGAGTACATTCAGTGAGCGCGGTTACCTCGTTCAGTGCCAGAGTTTCCAGTATGGCA
CGCTGTCGCATGAATATGATCCGAAGGGGTATATGGTGCGCTGGCGGGATACGGATAGCACGGATGTGGC
TGTCCGTTATGATATTTCAGGGCGGGTGGTGGCACTAAAAACATCGACCGGTTTTTTTGCCGACCATTTT
ATTTATCATGACAAAGAACGCTATACGATCTATCGCGATGGGGAAGGGGGAGAAACCGGTTATCACTATA
ATGAAAACAATCTGCTGATAAAGTTAGTCGATCCGTTAGGCAATACCACCCTCACCGACTGGGACTTGAC
CCAGAAAATAAAAGAAACCGATGCATTAGGGCGTATCACCCGGTTTATTTACAATGAGCGCGGTGATTTA
ACCGCCGTGATCCTCCCGGATGAAACCCGTACCGAATATGAGTATAACCCGTCTGGCGTGGTCACTGCGT
TTACGTCTTCGGCGGGGGATAGCTGGCAATATCAGTATGACAGGCAGGGATTGTTACGACAGGTAACTTA
TCCTTCCGGCCAGACGATGTCGTTTCGCTACGGCAAGAAGGGAGAAGTGCTGCGCAAGATCATCGCGGAA
GATCAGGTGTGGCGTTACCACTATGATCACCACGGTTGTTTAAGCACCATTATCGATCCGAAGGGGAACA
GTACAGCCGTCACACTGGATGTGCTGGGGCGGTTATTTTCTCACCAAAACGCCCTCGGGGAGCTCACCCG
TTACACACACAGTGACGCGCATGCCAGTCCGGCGGGCAGCGTCACAAAAATGGTCATGCCGGATGGTGTG
GAGCAGGCCATTGCCTATGACAGCGAGAAGCGTATTGCCGCGCTGACCGATGGCGCGGGGAAAACCACCC
GTTACGAATACGGGGGTTTTGATTTACTGACCGGCCTGATACGCCCGGACGGGCAGCGGCTGACCTTCGG
CTATGACACACTGACGCGCCTGAATCAGGTGACCAATGCGTCAGGTGACACCTATCGTTATACCCGTGAT
CGGGCCGGGCAGGTGATCAGCGAAACCGATTTTACCGGGCGCACGGTTCATTATCAGTATGATGCGGTGG
GGCGGCGTATCGGGGCGCGTTACCCGGATCAGCGCCTTGTTCGCTGGCACTACTCGATGCAGGATCAGGT
GCTGGCGCAGCAGACCTGGCACTGCGATGCACTGAGTTCCACGCTGGTTGGCACGGTCAGCTACGGTTAT
GACGGTGCCGGTCGTTTGCTGAGCGCGACCAATGCGGATGCGGTGGTGGAGTTTGATTACGACGAGGCGG
GTCAGTTGGTTGCGGAGCGGCTGAATGGCCGGGAGGTGCGGCATCAGTGGGATGCGCTAAACGGCACCCC
TGTTGCCCGACAGGTGGGTGAGCTGGGGCTGACGTTTGTGTACGGCGCACAGGGCGAACTGACCCGGCTA
CAGCTGGCGGGCCATCAGCCCCTTCAGTTGCAGCATGACCGGTTGGGGCGGGAGACGGTACGTGAAAGCG
CGGCCGGGTTTATTCAGGCCTGCAATTATACCCCGAGCGGGCTGTTGGCCCATCAGGCGGCCGGGCGTAA
CTCGGCATTATTCCAGCAACAGTTGATCGCCCCGGAGAGCCCGGCCTTGCACGGCAGTGCGGTCAACCGC
AGTTGGCAGTATGACCGGGCTTATAACGTGGTGGGGATGGATGACGGGCGTTGGGGTAAAACGCAGTACC
AATATGACCGCAATGACCAGGTCGTTCGCGCTGATTTTGGTGGTTTTTTGCCGTTGCAGGAGCAGTTTAG
CTACGATGTGAACCAGAACCTGCGCGAGCATCGCTGTTTACCGCGTGGGGCACAGGCGGTTTTGGCGCAG
GCGAGCCAGCAACAGCAGGCGGGCCGGGTGGTGAAGCGCGGTGACAGTCAGTACCGTTACGATGCTGCCG
GGCGACTGGTGGAGAAACGCAGCCAAAAAGACGGCTACCGGCCACAGCTGTGGCGCTACCGCTGGAATGA
GCAGGACCAGTTATCCGAATTGATCACGCCGACGGGGGCGCGCTGGCGCTACGGTTATGATGCCTTTGGG
CGACGTATTCGAAAACTGCGGGTAGTGGATACCCCGCCGCTCAATGAGATGGACGCTCCTTCCACCGGTC
CGGCCACGGCATCACTGGCCGGTTACGCGTACCTGTGGAGCGGCGACCAGTTAATCGAAGAGGTGCCGGT
GTATGCCGACGGCACGGTGGCGTATGAGCAGGGGATCCACTGGCTGTATGCGCCGGGCGGATTAACGCCG
ATGGCCCGCTACGCGCAAGGCAAACTGCATTATGTGGTGGCGGATCATCTGGGTACGCCGCGGGAGTTGT
TGAATGAGCAGGGCAAGGTGGTGTGGGCGAGCCGACTGAGCACCTGGGGGCAGGCGGAATTATGGCGACA
GGCGGCGAATGAGGAGGATCGGGTCAGCTGTAACCTGCGTTTTGCGGGTCAGTACGCGGATGCAGAATCC
GGGTTGCATTACAACCGGTTCCGCTACTATGATGGCGAGACGGGGCAATATCTATGCCCGGACCCGATAG
GGCTGGAAGGGGGATTAAACCCGTACGGGTATGTACATAATCCGGTGAGCTGGGTGGATCCGCTGGGGCT
GGCAACATGTCCAATGCGTGAAGTTAACGGAACAAAAATATTTGGTAAAGGCCAAAAAGATGGAACTCCT
GGTCATGATCAGTTCTCTGAAGTTATAGCCAATAAATTAGCCATGAGTGGTAAGTTTAAAGAGGTCTATT
TAAATAGGTCATATAATTTTGCTAATGGTAAAGGAATCTCAGGACGACGACCTGACATTATGGCTGTTGA
TATGAATGGTAAAGTTCATGCTATAGAATTGGCATCTAAAACAGATATGGGTAGAAAATTCCCATCTCTG
AGAACTCGAAACCAAGATGCAATGAAAAACTTACCAAGCATTGATCGGGGAAGTGTTATTGTATTAGAAC
ACCAATATAATTCTTCGAAGATTAAGAATGCATTAGATAATCTTATTTCTGGTATATAG