SecReT6
Protein ID: 145597847
SecReT6 ID201
T6SS typei2
Gene symbol-
Locus tagYPDSF_0539
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]601562..603106 [+]
Producthypothetical protein
NoteTssC
UniProt IDA4TI38
KEGG IDypp:YPDSF_0539
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-177, Aligned region: 14..51
DUF877 [PF05943], Evalue: 1.80E-177, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|145597847|ref|YP_001161923.1| hypothetical protein YPDSF_0539 [Yersinia pestis Pestoides F]
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSVFL
DLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELL
DISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHM
PFIGSVGPEFFGKENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVR
SFNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYA
VPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>ref|NC_009381.1|:601562-603106 hypothetical protein YPDSF_0539 [Yersinia pestis Pestoides F]
ATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGGCACAAG
GGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGAGGCGTT
CCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTCTTTTTA
GACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATATTGCCG
CACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGTGGAATC
GACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAGCTGCTG
GATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTTTATACG
CCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAACTACGA
GTTCGACCGTAGCCCGCAAGATATCGCGTTATTGCGCAATATCTCCAAGGTCGCGGCGGCAGCCCATATG
CCGTTTATCGGTTCCGTTGGCCCCGAGTTCTTTGGTAAAGAGAACATGGAAGACGTGGCAGCCATCAAAG
ATATCGCCAACTACTTTGACCGTGCTGAATACATCAAGTGGAAAGCCTTCCGCGACTCGGATGATTCCCG
CTATATCGGCCTGACCATGCCGCGCGTGCTGGGGCGTTTGCCTTACGGCCCGGACACGGTGCCGGTACGC
AGCTTCAACTACGTTGAGCAGGTGAAAGGGCCGGATCATGATCGCTACTTGTGGACCAATGCCTCATTTG
CCTTTGCTGCTAACATGGTGAAAAGCTTCATTAAAAATGGCTGGTGTGTGCAGATCCGGGGCCCGCAGGC
CGGTGGTGCGGTCACCAACTTACCGATCCACCTGTACGATCTGGGTACCGGTAATCAGGTCAAAATTCCG
TCAGAGGTGATGATCCCGGAAACCCGCGAGTTCGAGTTTGCCAATCTGGGCTTTATCCCGCTGTCGTACT
ACAAAAACCGCGATTACTCGTGCTTCTTCTCGGCCAACTCGGCGCAGAAACCGGCGCTGTATGACACCGC
GGATGCCACGGCCAACAGCCGCATCAACGCCCGTTTGCCGTATATCTTCCTGCTGTCGCGCATTGCCCAT
TATCTGAAACTGATCCAGCGCGAGAACATCGGCACCACCAAAGATCGCCGTCTGCTGGAGCTAGAGCTGA
ACAACTGGGTGCGCGGGCTGGTGACGGAAATGACTGATCCGGGTGATGATTTGCAGGCGTCCCATCCCCT
GCGTGATGCCAAAGTGACGGTCGAAGATATCGAAGACAACCCCGGCTTCTTCCGCGTCAAGCTGTATGCG
GTGCCGCATTTCCAGGTGGAAGGGATGGACGTCAATCTGTCATTGGTTTCCCAAATGCCAAAGGCTAAGG
CATAA