SecReT6
Protein ID: 145597848
SecReT6 ID201
T6SS typei2
Gene symbol-
Locus tagYPDSF_0540
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]603118..604470 [+]
Producthypothetical protein
NoteTssK
UniProt IDA4TI39
KEGG IDypp:YPDSF_0540
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.60E-135, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|145597848|ref|YP_001161924.1| hypothetical protein YPDSF_0540 [Yersinia pestis Pestoides F]
MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVLQATFELDALAQGRLKAARLHVRFQD
GVLVDTECADVLPPTLTLAASLPAEASDATVMLAIPQLYANGGNCLQPDERGERPVRYRQAWRDVQNQFG
DDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQ
LRARLQRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLT
FSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADF
YLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1353 bp     [Download]
>ref|NC_009381.1|:603118-604470 hypothetical protein YPDSF_0540 [Yersinia pestis Pestoides F]
ATGAAAATTGAACGCCCTCTGTGGGCTCGCGGGATCCTGGTGTCTCCGCAACAATTTCAACAACAGGCTT
CCTGGGAGGCATGGACCAATGAATGCATTGCGCAAATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGC
CACTTTTGAATTGGATGCATTGGCACAGGGCCGCCTGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGAC
GGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCTGCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCG
CCGAGGCCAGCGACGCCACGGTGATGCTGGCGATACCACAACTGTATGCCAATGGCGGTAACTGCCTGCA
GCCGGATGAGCGGGGCGAACGCCCGGTACGCTATCGTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGC
GATGACAAAAAGCAGGTCGCGGTGATGTACCACCAACTGACCCTGCGGCTGGACACTCAGGAAAACGGCG
ATTATCAGGTCTGCCCGGTGGCGCGTTTGCTGCGGGATGCGCAAGGTCGCTGGACACTGGATCCGGGCTT
TATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCTGGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAA
CTGCGGGCGCGTTTGCAGCGTCTGATGGGGATGCGCCGGGAGAGCAATGCACGGATGGCCGATTTTGCTG
TTGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCCCTTAACAGTGCCGAACCGGTATTGGGGAATTTTCA
GCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATCAGGAACTGGCCAGGCTGGCGGGCAGCCTGCTGACG
TTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGTTTATCAGCATGAACAACTGACCCGCGTCTTTCCCC
CGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCCAGCCTCCCTTCACGGGTAGTGGCGATTGAGCTGGT
TCATGAACCGCGTATCAATCAGTGGCGCGCGACCCTGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTC
TACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCAATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCG
GTGCGCCGGATGAGGTCGGTAACGTGGTGAATGTTGCGCTGAGTGGGATCCCACTGCGCCCGCTGAGCCA
TGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACCAGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCG
ACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTATGTACCCGGTACGCTGGGTGAGATCCAACTGGAGC
TGTTTGCGGTGCTACGCGCATGA