SecReT6
Protein ID: 145597854
SecReT6 ID201
T6SS typei2
Gene symbol-
Locus tagYPDSF_0546
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]610447..612795 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA4TI45
KEGG IDypp:YPDSF_0546
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.70E-65, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 1.60E-48, Aligned region: 610..751
T6SS_Vgr [PF13296], Evalue: 5.10E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 5.10E-35, Aligned region: 589..618
Phage_base_V [PF04717], Evalue: 1.90E-16, Aligned region: 393..481
Protein Sequence: 782 a.a.     [Download]
>gi|145597854|ref|YP_001161930.1| Rhs element Vgr protein [Yersinia pestis Pestoides F]
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPADLQAQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQMSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGPITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAA
KTEDPIKRWLFS
 
Nucleotide Sequence: 2349 bp     [Download]
>ref|NC_009381.1|:610447-612795 Rhs element Vgr protein [Yersinia pestis Pestoides F]
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTGACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCGACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGGGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGACCGCAGGCAGTGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGTCACCGGG
TCAGGAACTGAAAGTCACCGGCAACGACGTGCCAGCACAGTTTGGCAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGTATT
GCTTCCGCCCGATCCTCATCAACAAGCCAAAAATGGCCGGCACCTTGCCCGCACGGGTCACCAGCACCAC
GGTGAACGACACTTACGGACACATCGACAAAGACGGCCGCTACCGTGTCAATCTGATGTTTGACCGGGAC
AGTTGGGAGCAAGGTTACGAAAGCCTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCCGGCACCGAAGTGGCGATTGCATTTGAGGACGGCAACCCGGACCGGCCGTA
TATCGCCTCTGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGCACTCCGTCGAACAACAAACTGCGCCTGGAGGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATCTGGTCGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGCCTTGCGGGCAGAAAAAGGGATTTTCATCAGCGCTGAC
GGCCAGGCGAAGGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCAGATGCACAAACCGCCACCGCCAGTCCGGCCGACCTGCAGGCACAAAT
CAGTTTGTTACAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGTAGCGGGGAGCATCTGCAAATGAGTGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATGTCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCGTATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGACCAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAACCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGGTTAGATAAGGCCAAGCTCCCAACTGAATTTCCAGCCTTAGCCGCT
AAAACTGAAGACCCCATTAAACGTTGGCTATTCTCTTAA