SecReT6
Protein ID: 145599314
SecReT6 ID203
T6SS typei3
Gene symbol-
Locus tagYPDSF_2036
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]2293803..2296082 [-]
Producthypothetical protein
NoteTssI
UniProt IDA4TMA5
KEGG IDypp:YPDSF_2036
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.20E-76, Aligned region: 29..347
Phage_base_V [PF04717], Evalue: 3.00E-24, Aligned region: 387..480
Protein Sequence: 759 a.a.     [Download]
>gi|145599314|ref|YP_001163390.1| hypothetical protein YPDSF_2036 [Yersinia pestis Pestoides F]
MSRTINLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTI
EMELDGNGLGDVRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDII
EEVFSDYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRS
FSTAYHAIEYLSDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHW
PGDYDQPDIGEHLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVD
QLSGGEDAFSCESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGT
NSESDSCWLRVSQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGM
VSRTVGGGLTNYNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDV
LGTSMLAIGAASMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGSATL
AAGGPIAIGAGGELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGA
IALPLPLPLLPIVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPEPTRTPPGTQTPPP
 
Nucleotide Sequence: 2280 bp     [Download]
>ref|NC_009381.1|:c2296082-2293803 hypothetical protein YPDSF_2036 [Yersinia pestis Pestoides F]
ATGTCAAGGACAATAAATTTGAGCAGCCCGGCTATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGT
CTAAGTTGGAAGGCGAGGAAGCCTTTTCGACTTTATATTCTTATACTATTACGGCAAAGACACCGGCTAA
CCCATTAATTCCTTGGCAAGCGGCTTCAAATGTCGATCTCAAATCCTTAATTGGTAAAGAGATGACGATT
GAAATGGAACTGGACGGCAACGGCCTGGGTGATGTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGG
GGCTGGTTGAGAGAGCCAGATACATTGGTCGAGATGCCAATCAGGCCATATTTGAGATCACTATTAAGCC
TTGGTTCTACCTGGCTAATTTAACCTCTGACTTTAAAATTTATCAAAATAAAAATGTCGTTGATATTATA
GAGGAAGTGTTCTCAGACTATAATTTTCCGTTTGAGAAACGGTTGGCTACAACCTATCCGATATTAGATT
TTCAGGTTCAGTACGGTGAAACCGACTTTAATTTCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTG
GTTCTTTGAGCATCAGGATCATAAACAAAAATTAATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCG
TTCAGTACCGCCTACCATGCCATTGAGTACTTGTCGGATGAGCCTAAAGCGGGCGAAGAGTACATCACAC
AATTCCAGACTCAGGAAACCTTGACGAGTGGGACCTGGGTCACCAACGATTATGACTTCACGAAATCCCG
TGCCGATATTCTGGCAATGGACAGTAAACCGCGTAAAACCAGCTTTAACGATCTCGAGATTTATCACTGG
CCAGGGGATTATGATCAGCCAGATATTGGTGAGCACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTC
TGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGCGCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGG
GTTCCCCGTTGATAAAGCGAATCGGGAATACATGATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGAT
CAACTGTCTGGCGGTGAGGATGCGTTTAGTTGCGAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCT
ATCGTCACCCACAGGTGACACCAAAACCGAAAACCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACC
GGGTGAAGAGATTTGGACCGATGAATATGGCCGCGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACA
AACAGCGAGTCAGACTCTTGCTGGCTACGTGTTAGCCAGGCTTGGGCAGGGAACAGCTTTGGTGGGATCT
ATATTCCACGCATTGGTCAGGAAGTCATTGTTGACTGTATTAACGGCGATCCTGACCGGCCAATGGTGAT
GGGCAGCCTTTATAATAACGTGACGCGTCCCCCTTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATG
GTCAGTCGTACCGTTGGCGGCGGGTTAACCAACTATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGG
AGCAGTACTGGGAACAGGCCGAGCGCGATATGTCGCGTTTGACTAAAAATAATGAAACGCAAATTATCGG
TGCCGATTCTGTCCTGAATGTAGGGGCCAACCGAAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTT
CTTGGCACATCAATGTTAGCCATCGGTGCAGCCTCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGG
TTGGCGGAGCACATTCACTGAATGTGGTTTTGGCGAATGCCACCAATGTGGGTGGCGCTAACATGACCAA
CGTAGGGGGGTTTAATGGCCTTGCGGTGGGGGGAGCCCATCAGACAGCTGTAGGCGGTTCTGCGACACTG
GCTGCCGGCGGCCCTATTGCTATTGGGGCGGGTGGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTG
TTGGTAAAAGTAAGGTTATTATTCAGGGCGGTGAAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAA
AACGGGCAATGGCGGCGGGGCATTCGGTGCCTTTGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCT
ATTGCCTTACCGCTACCGTTACCCTTGTTGCCAATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAA
CAGTGCCACCGGATCCGACATTGCCACCGGATCCGACATTGCCACCAGATCCAACGTTACCGCCGGAACC
GACGCGAACACCGCCAGGGACGCAGACGCCACCGCCTTGA