SecReT6
Protein ID: 145599315
SecReT6 ID203
T6SS typei3
Gene symbol-
Locus tagYPDSF_2039
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]2300211..2301047 [-]
ProductOmpA family protein
NoteTssL
UniProt IDA4TMA6
KEGG IDypp:YPDSF_2039
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-18, Aligned region: 18..111
OmpA [PF00691], Evalue: 1.70E-16, Aligned region: 172..270
Protein Sequence: 278 a.a.     [Download]
>gi|145599315|ref|YP_001163391.1| OmpA family protein [Yersinia pestis Pestoides F]
MGRWWRYKWITFHPSLTYADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALS
PHGLIAHQNRRRRGIFVPVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLR
LSILLKDEIAKQLVSVDETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDS
MPINKPGFPNNQVLSEKRAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 837 bp     [Download]
>ref|NC_009381.1|:c2301047-2300211 OmpA family protein [Yersinia pestis Pestoides F]
TTGGGCCGTTGGTGGAGATATAAGTGGATCACTTTTCATCCGTCGTTGACATATGCGGATGGTTTAGAGG
TTTTGCTGCGCATTTTAGGGCTCGGTTTTGAGGGGCGCTACAGCATTATCGAAGATGGTGATCGGCAATT
AACTAAAATACGCCAAGGGTTGCTGACGCTGCTCCAAAGTACCCGAGACACGATCCCACCGGCACTTTCT
CCGCATGGGTTGATCGCACATCAAAACAGAAGACGGCGGGGCATTTTTGTTCCGGTGCGCGTATCCATGC
TGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAATACTTTCTCTCGGTACCGGAAAGTGA
CTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCCACCCGTTGCCGCACCAAAACTTCGA
CTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGTGTTGATGAAACGAGCAACAACAGCA
AAGTCATCTTTAAAGGCGACTCTATGTTTATGGTCGGCTCGGATAACGTCAGACCTGAAATGATTGACGT
AATTAAACGCGTCGCGCAGGAAGTGCATCGCGTTAAAGGGGCAATCCTCATCGTCGGGCATACAGACTCT
ATGCCGATTAATAAACCCGGCTTCCCTAATAACCAGGTACTTTCCGAAAAACGCGCGGCCAATGTTGCAC
GCTATATGGAGCAGGCCGGTATTCCAACCGACAAAATTCGGTTTGAGGGCAAGGGGGAAACGCAACCGGT
TAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGTAGAAATTTTTGTTAATTATTGA