SecReT6
Protein ID: 145599318
SecReT6 ID203
T6SS typei3
Gene symbol-
Locus tagYPDSF_2042
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]2302878..2303546 [-]
Producthypothetical protein
NoteTssL
UniProt IDA4TMA9
KEGG IDypp:YPDSF_2042
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-29, Aligned region: 86..198
Protein Sequence: 222 a.a.     [Download]
>gi|145599318|ref|YP_001163394.1| hypothetical protein YPDSF_2042 [Yersinia pestis Pestoides F]
MSDSSDLNLGGSMPPFDRSRNVDESPQALGRFLLDEPMTSPDSTQDNTAFTREAPHSGVAQQYDTTLLRG
ESVQQRVAKVLASSTPLLEAAQPLLRALSEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGMMAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYAVTNGAIVIHTQ
RLKSDPGGNLLS
 
Nucleotide Sequence: 669 bp     [Download]
>ref|NC_009381.1|:c2303546-2302878 hypothetical protein YPDSF_2042 [Yersinia pestis Pestoides F]
ATGAGTGACAGCAGTGATTTGAACCTTGGAGGCTCAATGCCTCCTTTTGATAGAAGCAGAAATGTGGATG
AGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAGCCAATGACATCCCCAGATAGCACTCAGGATAA
TACGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGTGGCACAGCAATATGACACGACCCTCTTACGGGGT
GAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCACAGCCAC
TATTACGTGCCTTGAGCGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAAAACAAAG
CCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAAAATGGCT
ATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATGATGGCAG
GTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTTTCTTATT
GGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCTGTAACGAACGGTGCAATAGTGATCCACACCCAA
CGCCTGAAATCAGATCCAGGGGGTAATCTGCTCTCCTGA