SecReT6
Protein ID: 145599330
SecReT6 ID203
T6SS typei3
Gene symbol-
Locus tagYPDSF_2054
StrainYersinia pestis Pestoides F
Repliconchromosome [GenBank: NC_009381] [Browse all T6SS(s) in this replicon]
Location [Strand]2315055..2317730 [-]
ProductClp ATPase
NoteTssH
UniProt IDA4TMC1
KEGG IDypp:YPDSF_2054
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 231..311
AAA_2 [PF07724], Evalue: 1.20E-39, Aligned region: 619..785
AAA [PF00004], Evalue: 4.00E-21, Aligned region: 233..364
AAA [PF00004], Evalue: 4.00E-21, Aligned region: 624..741
ClpB_D2-small [PF10431], Evalue: 1.80E-16, Aligned region: 791..869
AAA_5 [PF07728], Evalue: 3.70E-13, Aligned region: 233..311
AAA_5 [PF07728], Evalue: 3.70E-13, Aligned region: 623..741
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 271..311
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 498..517
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 621..659
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 688..711
AAA_16 [PF13191], Evalue: 1.80E-08, Aligned region: 787..811
Sigma54_activat [PF00158], Evalue: 2.20E-07, Aligned region: 228..312
Sigma54_activat [PF00158], Evalue: 2.20E-07, Aligned region: 623..722
AAA_22 [PF13401], Evalue: 5.70E-07, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 5.70E-07, Aligned region: 366..399
AAA_22 [PF13401], Evalue: 5.70E-07, Aligned region: 621..643
AAA_22 [PF13401], Evalue: 5.70E-07, Aligned region: 685..710
AAA_14 [PF13173], Evalue: 3.70E-06, Aligned region: 233..314
AAA_14 [PF13173], Evalue: 3.70E-06, Aligned region: 622..705
AAA_25 [PF13481], Evalue: 5.60E-06, Aligned region: 233..257
AAA_25 [PF13481], Evalue: 5.60E-06, Aligned region: 621..648
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 231..256
AAA_19 [PF13245], Evalue: 1.80E-05, Aligned region: 621..645
IstB_IS21 [PF01695], Evalue: 3.90E-05, Aligned region: 227..252
IstB_IS21 [PF01695], Evalue: 3.90E-05, Aligned region: 623..643
Zeta_toxin [PF06414], Evalue: 5.40E-05, Aligned region: 233..253
Zeta_toxin [PF06414], Evalue: 5.40E-05, Aligned region: 616..663
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 25..74
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 112..122
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 223..253
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 621..648
NACHT [PF05729], Evalue: 8.70E-05, Aligned region: 233..264
NACHT [PF05729], Evalue: 8.70E-05, Aligned region: 623..650
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 212..246
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 286..383
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 622..668
AAA_17 [PF13207], Evalue: 0.00044, Aligned region: 63..109
AAA_17 [PF13207], Evalue: 0.00044, Aligned region: 234..252
AAA_17 [PF13207], Evalue: 0.00044, Aligned region: 377..406
AAA_17 [PF13207], Evalue: 0.00044, Aligned region: 623..658
AAA_18 [PF13238], Evalue: 0.0031, Aligned region: 233..252
AAA_18 [PF13238], Evalue: 0.0031, Aligned region: 625..649
AAA_23 [PF13476], Evalue: 0.0075, Aligned region: 233..253
AAA_23 [PF13476], Evalue: 0.0075, Aligned region: 469..542
AAA_23 [PF13476], Evalue: 0.0075, Aligned region: 621..646
UPF0079 [PF02367], Evalue: 0.0078, Aligned region: 233..253
UPF0079 [PF02367], Evalue: 0.0078, Aligned region: 621..650
Protein Sequence: 891 a.a.     [Download]
>gi|145599330|ref|YP_001163406.1| Clp ATPase [Yersinia pestis Pestoides F]
MAITRKHLFGKLDATLFKGIESATTICKLRGNPYVELVHWLNQLWHQEDNDLKQIIRYFAVDVDAFEREL
AQALAKLPVGATSISDFSYHIELATERAWIYASLECLDTRIRSGHLLLALLTTMELRRAFFAIAPSMEKI
PLEHLSKDLNFITQASPEANEAASDGSPLYDGALPGEASNAIGAAKSGGALAQYTTDLTALAREGKIDPV
LGRNHEINTMVDILLRRRQNNPLLTGDAGVGKTAIVEGLALAIAAGSMPPALSQVSLLSLDIVALSAGAS
MKGEFEARLKSVLDEAIAAEKPVILFIDEVHTLIGAGGNAGTGDAANLLKPALARGQLRTIGATTWSEFK
RHIEKDPALTRRFQVLQVDEPDENTAISMLRGLIPALEKHHGVWIMDEALQAAVRLSHRYIPARQLPDKA
ISLLDTACARIAVAQFSQPIELQHLTFQSETAQTELVSLEKARHFGKAQDARTEQLKTSIAEHGEAADKL
DQRWQAERELVSAITTIRTALYDLVSQPEPDEEKRRAYQAQLVQLEAQLSQVRTSLPLVQTEVNAEVIAS
IVADWTGIPVGQMLKDDIRAVMELPQRLEARVIGQPHALMQLGENIMTARAGLSDPRKPLGVFMLVGPSG
VGKTETALAIAESMYGGEQNMITINMSEYQESHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDE
IEKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTSNVGSELLSNLLADPDTAPDQDGILSALQPE
LLKVFPAAFLGRVTVIPYLPLQQDALQHIVRLHLDRIGARLYSQHQLTLKYSDEVVEDVVSRCAVSETGA
RMLIRYIEQNITPKIGKYILGDSDVKPEQIIFVHKNENGFVIALQCKDDEN
 
Nucleotide Sequence: 2676 bp     [Download]
>ref|NC_009381.1|:c2317730-2315055 Clp ATPase [Yersinia pestis Pestoides F]
GTGGCTATTACAAGGAAACATCTCTTCGGCAAGCTGGACGCCACTCTTTTCAAAGGTATTGAAAGCGCAA
CAACGATTTGTAAATTACGCGGCAATCCTTACGTAGAGTTAGTTCACTGGTTGAATCAGCTTTGGCATCA
GGAAGATAACGACCTTAAGCAGATTATTCGGTATTTTGCGGTGGATGTGGATGCCTTTGAGCGTGAACTG
GCTCAGGCACTTGCGAAGTTACCTGTTGGGGCAACTAGCATTTCAGATTTTTCGTATCATATTGAGTTGG
CCACGGAACGGGCTTGGATCTATGCCAGCCTGGAGTGTTTAGATACCCGTATCCGCAGCGGACATCTGCT
GCTTGCGCTATTAACCACAATGGAACTGCGGAGAGCTTTCTTTGCGATTGCGCCAAGCATGGAAAAAATT
CCATTAGAGCATTTAAGCAAAGATTTGAACTTCATTACGCAGGCATCACCAGAAGCGAATGAAGCCGCCA
GTGATGGCAGCCCGTTGTACGATGGTGCTTTACCTGGCGAAGCCAGTAATGCCATTGGTGCAGCCAAAAG
TGGTGGCGCACTGGCTCAATACACCACAGACCTCACGGCATTAGCACGTGAAGGCAAGATAGATCCGGTA
TTGGGACGTAATCACGAAATCAACACAATGGTTGATATTCTCTTGCGCCGTCGGCAGAACAACCCATTAC
TTACCGGTGACGCAGGGGTGGGTAAAACCGCCATTGTTGAAGGGCTAGCATTGGCTATTGCTGCTGGCTC
AATGCCACCAGCATTAAGCCAGGTAAGCCTGTTGTCATTAGATATTGTGGCGCTCTCAGCGGGTGCCAGC
ATGAAAGGTGAATTTGAAGCGCGCCTGAAGAGTGTCTTGGATGAAGCGATAGCGGCAGAAAAGCCCGTTA
TTTTGTTTATCGATGAAGTACACACACTTATTGGCGCGGGTGGCAATGCCGGGACCGGCGATGCGGCGAA
CTTATTGAAACCTGCATTGGCGCGTGGCCAGTTACGTACCATTGGTGCGACAACGTGGAGCGAGTTCAAG
CGTCACATTGAGAAGGATCCGGCACTCACCCGTCGTTTCCAAGTACTTCAAGTTGATGAGCCCGATGAGA
ACACGGCGATCTCCATGTTACGGGGCCTGATACCTGCGCTAGAAAAGCACCACGGCGTGTGGATTATGGA
CGAAGCTTTACAGGCGGCAGTACGGTTGTCTCATCGTTATATCCCTGCGCGTCAGTTGCCGGATAAAGCG
ATAAGTCTGCTTGATACGGCTTGTGCACGGATCGCTGTCGCGCAGTTTTCACAACCAATAGAGCTACAGC
ACTTAACCTTCCAGAGTGAGACGGCGCAAACTGAGCTGGTTTCCTTAGAGAAAGCGCGGCACTTTGGTAA
AGCGCAGGATGCGCGTACTGAGCAGTTGAAAACATCCATTGCTGAACATGGCGAGGCTGCGGATAAGCTT
GATCAGCGTTGGCAGGCAGAACGCGAATTGGTATCAGCGATTACGACCATAAGAACCGCACTGTATGACT
TGGTTTCTCAGCCAGAGCCTGATGAGGAAAAACGTCGGGCTTATCAAGCGCAATTAGTTCAGTTGGAAGC
GCAGCTTTCTCAGGTTCGCACTTCACTGCCGTTAGTGCAGACAGAAGTCAACGCTGAAGTGATTGCCAGT
ATCGTTGCGGATTGGACCGGCATTCCGGTTGGGCAAATGCTCAAAGACGATATTCGGGCGGTAATGGAGT
TGCCACAGCGCCTTGAAGCACGTGTTATTGGTCAGCCCCATGCATTGATGCAACTGGGTGAAAATATTAT
GACCGCACGCGCTGGCCTGTCAGACCCAAGGAAACCATTGGGGGTCTTTATGTTAGTGGGGCCTTCAGGT
GTGGGTAAAACAGAGACGGCCTTAGCGATCGCCGAGAGCATGTATGGTGGTGAACAGAATATGATCACTA
TCAATATGAGCGAATATCAGGAATCGCATACCGTTTCCTCTTTAAAAGGTTCTCCACCGGGATATGTTGG
ATACGGTGAAGGCGGTGTGTTAACGGAAGCTGTGCGCCGTAAGCCATATAGTGTTGTGTTGTTAGATGAA
ATCGAAAAAGCGCACTCTGATGTACATGAGTTATTCTTCCAAGTGTTTGATAAAGGCCAAATGGAAGATG
GTGAAGGGCGTTTTATCGATTTTAAAAATACTATCTTGTTGTTAACCAGTAATGTGGGCAGCGAGTTACT
GAGTAACTTATTAGCTGATCCAGATACTGCACCGGATCAGGATGGAATATTAAGTGCGTTGCAACCTGAA
TTGCTGAAAGTTTTCCCCGCAGCATTTTTAGGGCGAGTTACGGTTATTCCTTATCTTCCGTTACAGCAAG
ATGCATTGCAGCATATTGTACGGTTGCATTTAGATCGGATTGGCGCTCGTTTATACTCGCAGCATCAATT
GACACTGAAATACAGTGATGAAGTGGTTGAAGATGTTGTTAGCCGCTGTGCGGTCTCAGAGACCGGTGCG
CGTATGCTGATCCGTTACATTGAACAAAATATTACGCCAAAAATAGGTAAATATATTTTAGGTGATAGTG
ATGTGAAGCCTGAGCAAATTATTTTCGTTCATAAAAATGAAAATGGATTCGTGATCGCTTTACAGTGTAA
AGATGACGAAAACTAA