SecReT6
Protein ID: 146300998
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3254
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3892562..3894397 [-]
Producthypothetical protein
NoteTssF
UniProt IDA5FEU5
KEGG IDfjo:Fjoh_3254
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 0.0013, Aligned region: 26..199
DUF879 [PF05947], Evalue: 0.0013, Aligned region: 302..319
Protein Sequence: 611 a.a.     [Download]
>gi|146300998|ref|YP_001195589.1| hypothetical protein Fjoh_3254 [Flavobacterium johnsoniae UW101]
MRQDRIKDRVLKRAARSWGFSDVEMETSFDPVVSMMLNALSYELEKVAHELEDSKTRVVERVLEIMFPEV
TAGVKPARAILHALPIENGMKVSLQNQMSASRRIHNIYNPLAPITKEIALSPTLEVKLSSAEIKYVAYER
NLFEISNLFYKDAIRDYKHSLPSGVVFLGIELTNPKVEEIEDLMLYIDIKNTHQKEMFHYYLKQMKCFQD
DVQITVEEGYNVPVNNIDIENIINRNYTHLSEIMQEVNEFYFDNFYTLKGSLKHKAINEYSEEYKYFEAV
TSGNDNPIIWVKMIFPESLIPQILDNVSFTANCFPVINKKKHIINKTLGNFLSYIALETDNNIYLDVDTV
IDGFNNHYEIKEFKDGVIEEGNAVLRTGGVSRFDSRSASELLQNVLDLLKDESSSFAGLGKDFMNSSLVE
INQLLASVEQQARESSFSKNNDPYLMIKPKFDESIGKSFSIHYWSTCAEEGNDIKAGTVLEAKDDMLFVS
KESVLITNTVGGMNKQNNKDRILAYRNALLTRGRIVTFADIKAFGFNHFKSCITDIRIEKGTRKEISVKA
GFSRTVDIHLQVNPVEKDYLSETEWDYLCDSFMKQLKNRSSNVFPYRIFVN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3894397-3892562 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGAGACAAGATCGAATAAAAGACAGAGTGCTAAAAAGAGCGGCTAGATCATGGGGCTTTTCTGATGTTG
AGATGGAAACATCATTTGATCCTGTTGTATCAATGATGCTTAATGCATTGTCTTACGAATTAGAAAAAGT
AGCCCACGAACTCGAAGACTCTAAAACAAGAGTTGTAGAAAGAGTTCTGGAAATTATGTTTCCTGAAGTT
ACAGCAGGAGTAAAACCTGCACGAGCCATTTTACATGCTTTACCAATAGAGAATGGTATGAAAGTTTCAT
TGCAGAACCAAATGTCGGCAAGTCGAAGAATTCATAATATTTACAATCCTTTAGCACCAATTACTAAAGA
GATCGCTTTATCGCCAACGTTAGAAGTAAAGCTGTCTTCGGCAGAAATAAAATATGTAGCTTATGAACGC
AATTTGTTCGAAATTTCGAATCTTTTTTATAAAGATGCCATACGAGATTACAAACATTCACTGCCTTCAG
GTGTTGTGTTCTTAGGAATTGAATTAACGAATCCGAAAGTTGAAGAGATAGAAGATTTAATGTTGTATAT
CGACATTAAAAATACACATCAGAAAGAGATGTTTCATTACTATTTAAAGCAAATGAAATGCTTTCAGGAT
GATGTGCAGATTACAGTAGAAGAAGGCTATAATGTTCCTGTAAACAATATAGACATTGAGAATATTATCA
ACCGTAATTACACACATTTGAGTGAAATTATGCAGGAGGTAAATGAATTTTATTTTGATAATTTCTATAC
CCTGAAAGGTTCTTTAAAGCACAAAGCAATTAATGAATACAGTGAAGAATATAAATATTTTGAAGCTGTA
ACCAGCGGAAATGACAATCCTATTATTTGGGTAAAAATGATTTTCCCGGAATCGCTGATTCCTCAAATAT
TAGATAACGTTTCTTTTACAGCAAATTGCTTTCCGGTAATCAACAAAAAGAAACACATTATAAATAAAAC
GCTTGGTAACTTCTTATCCTATATTGCATTAGAAACAGATAACAATATTTATCTCGATGTTGACACTGTT
ATCGATGGATTCAATAATCATTATGAGATAAAAGAATTTAAAGATGGTGTAATTGAAGAAGGAAATGCTG
TATTACGAACAGGCGGAGTTTCCAGATTCGATTCAAGAAGCGCATCAGAATTGCTTCAAAATGTATTAGA
CTTACTAAAAGACGAAAGTTCTTCTTTTGCTGGTTTAGGTAAAGATTTTATGAACAGCTCTTTAGTCGAA
ATCAATCAGCTCTTAGCTTCTGTAGAACAGCAGGCAAGAGAAAGCAGCTTTTCTAAAAATAATGATCCTT
ATTTAATGATTAAGCCAAAGTTTGATGAATCTATAGGAAAATCATTTTCTATACATTACTGGTCAACATG
TGCCGAAGAAGGAAACGATATAAAAGCAGGAACAGTTTTAGAGGCCAAAGATGACATGCTTTTTGTAAGC
AAAGAGTCGGTGCTGATTACAAATACTGTTGGCGGTATGAACAAACAGAATAACAAAGACCGTATTTTAG
CGTACAGAAATGCTTTGCTGACACGCGGCCGAATTGTAACATTTGCTGATATAAAAGCTTTTGGATTTAA
TCATTTCAAAAGTTGTATAACAGACATTAGAATAGAAAAAGGCACGCGAAAAGAAATATCTGTAAAAGCT
GGTTTCAGTCGTACAGTAGATATTCATCTGCAGGTAAACCCTGTTGAAAAAGATTATTTATCAGAAACAG
AATGGGATTATTTATGCGATAGTTTTATGAAACAGCTCAAAAACAGATCCTCAAATGTGTTTCCTTATCG
AATATTTGTAAATTAA