SecReT6
Protein ID: 146301000
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3256
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3895387..3895947 [-]
Producthypothetical protein
NoteFti1 (i)
UniProt IDA5FEU7
KEGG IDfjo:Fjoh_3256
PDB IDNA
Domain hit(s) vs Pfam UPF0118 [PF01594], Evalue: 0.0023, Aligned region: 2..90
Wzy_C [PF04932], Evalue: 0.0025, Aligned region: 4..81
DUF4281 [PF14108], Evalue: 0.0073, Aligned region: 8..64
Protein Sequence: 186 a.a.     [Download]
>gi|146301000|ref|YP_001195591.1| hypothetical protein Fjoh_3256 [Flavobacterium johnsoniae UW101]
MIYTLLIILLLEIIFIYLKKWQTKRKILIAICTVIITVIIYVVLLAVLWNSSTDKREDIQQVNEYQVQNF
KTILFNNQFNKKVYVIINFEYTKDEIKKNNLKIVDFYNKTDSILLKPNEKNSIFLPVYNNTFVRFPINFK
VTIKDSVSKVIKSYDEELFYKESKSEPKIEKVQEKYKSDEWELIIK
 
Nucleotide Sequence: 561 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3895947-3895387 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGATTTATACTTTATTGATTATTCTGTTGTTAGAAATTATTTTCATTTATTTAAAAAAATGGCAGACTA
AAAGAAAGATTTTAATAGCAATTTGTACAGTAATCATTACAGTGATTATATATGTTGTTTTATTAGCAGT
ACTTTGGAATTCATCGACGGATAAAAGAGAAGATATTCAGCAGGTGAATGAATATCAAGTGCAAAACTTT
AAAACAATTTTGTTCAATAATCAGTTTAATAAAAAAGTGTATGTAATTATCAATTTTGAATACACTAAAG
ATGAGATAAAAAAAAATAATTTAAAAATTGTTGATTTTTATAATAAAACAGATTCTATACTATTAAAACC
AAACGAAAAGAATAGCATTTTCCTGCCAGTTTACAATAATACATTTGTTCGATTTCCAATAAATTTTAAA
GTTACAATCAAAGATTCCGTATCTAAAGTAATTAAAAGTTATGATGAAGAATTATTTTATAAAGAATCAA
AATCAGAGCCAAAAATTGAAAAAGTACAAGAAAAATACAAATCTGACGAATGGGAATTAATAATTAAATA
G