SecReT6
Protein ID: 146301001
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3257
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3895944..3897596 [-]
Producthypothetical protein
NoteFte1 (e)
UniProt IDA5FEU8
KEGG IDfjo:Fjoh_3257
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 550 a.a.     [Download]
>gi|146301001|ref|YP_001195592.1| hypothetical protein Fjoh_3257 [Flavobacterium johnsoniae UW101]
MSRIRLVRGTITKTTGGDHNIYSEGNIVYNSGQAVTETSDTGIKYGDPKDIPQRKNDDFDITFELDKKTK
SVVPLGILDFKNNAENPYFCFKFGLKKTSIDSLNFQIIGENDEIIYQMTYLQTIIVKASELPKIFSNIPK
STQEPILSKIWDFQKIYNEFASSPGDYTKEGEYVIHWDGFDNNDVYDSTKFNNKKLKARITATKGDKQKS
LTIDFSTNYTQVQWTDVKIDRSKKRIDITLRVDLRDGGTKGLNCYTYNLPEESSYETFTPTTGTDPLKGY
KTTICDWDKIPASELNPAQPVLKTRTKSFEELKKLAFEGLERYWGRNKNNIVGNNVNIIDSYEVFIKPID
TTKNALNSLPLVYNTNGGWMRSGNPGASYDDGNLDDDLLNALPDLGVIQRLSYNAGYIKHDWKNDAHNGW
RYHIEKDSNTYYDEVSNFKETAAHELGHEFLQAYAGTAFSWQHKGSSYYLPQDTKPIKGDETFWGKMTHM
DEMPETSGEYYPKNGEIDLMKYYNTTDKAGKFVAGADLKRTIAAEKDVLGLIWLTKLKIQ
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3897596-3895944 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGAGCAGAATAAGATTAGTTAGAGGTACTATAACAAAAACTACCGGAGGTGATCACAATATTTATTCTG
AAGGTAATATTGTATATAATTCTGGTCAGGCTGTAACCGAGACGAGTGACACAGGAATTAAGTACGGAGA
TCCGAAAGATATCCCTCAAAGAAAAAATGATGATTTTGATATTACATTTGAATTAGATAAAAAAACAAAG
TCAGTTGTTCCTTTGGGTATTTTAGATTTTAAGAATAATGCAGAAAATCCTTATTTCTGCTTTAAATTTG
GTTTAAAGAAGACATCAATTGATTCTTTAAATTTTCAAATAATAGGTGAAAATGATGAAATTATTTATCA
AATGACCTACTTACAAACGATTATAGTAAAAGCTTCTGAACTTCCTAAAATCTTTTCAAATATACCCAAA
TCAACACAAGAACCAATTTTATCTAAAATTTGGGATTTTCAAAAAATTTATAATGAATTTGCATCTTCAC
CAGGTGATTACACTAAAGAAGGTGAATATGTTATTCATTGGGATGGTTTTGATAATAATGATGTTTATGA
CAGCACCAAATTCAATAATAAGAAGTTAAAGGCTAGAATTACGGCTACCAAAGGTGATAAGCAAAAAAGT
TTGACAATAGATTTTTCTACTAATTATACTCAAGTACAATGGACTGACGTAAAAATTGATAGAAGCAAGA
AACGAATTGATATAACCTTAAGAGTAGATTTAAGGGATGGTGGTACAAAAGGTTTGAATTGTTATACTTA
TAATTTACCTGAGGAGTCAAGTTATGAAACGTTTACCCCGACTACAGGAACTGATCCTCTTAAAGGGTAT
AAAACAACTATTTGCGATTGGGATAAAATACCGGCTTCGGAATTAAATCCTGCACAACCGGTTTTAAAGA
CTAGAACAAAATCTTTTGAAGAATTAAAAAAACTTGCTTTTGAAGGTCTGGAAAGATATTGGGGAAGAAA
TAAAAATAATATTGTTGGTAATAATGTAAATATTATTGATTCTTATGAAGTATTTATAAAACCAATTGAT
ACTACTAAAAATGCTCTAAATTCTCTACCGTTGGTGTATAATACTAATGGAGGATGGATGCGGTCAGGTA
ATCCTGGAGCAAGCTATGATGATGGTAATTTAGATGATGATTTGTTAAATGCTCTTCCAGATTTAGGTGT
AATACAAAGATTATCTTATAATGCAGGATATATTAAACATGATTGGAAAAATGATGCTCACAACGGATGG
CGCTATCATATTGAAAAAGATTCAAATACGTATTATGATGAAGTTTCAAATTTTAAAGAAACAGCTGCTC
ATGAATTAGGACATGAATTTTTACAAGCCTATGCAGGAACAGCATTCTCATGGCAGCACAAAGGAAGTTC
ATATTATTTACCTCAAGATACTAAGCCTATAAAGGGAGATGAAACCTTTTGGGGTAAAATGACTCATATG
GATGAAATGCCTGAAACTTCAGGAGAATATTATCCTAAGAATGGTGAAATAGACCTAATGAAATATTATA
ATACTACTGATAAAGCAGGGAAATTTGTTGCAGGGGCTGATTTAAAAAGAACAATTGCTGCAGAAAAGGA
CGTATTAGGTCTGATATGGTTAACAAAACTTAAAATACAATGA