SecReT6
Protein ID: 146301004
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3260
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3899844..3901652 [-]
ProductRhs element Vgr protein
NoteVgrG
UniProt IDA5FEV1
KEGG IDfjo:Fjoh_3260
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 1.80E-18, Aligned region: 361..443
Phage_GPD [PF05954], Evalue: 2.90E-14, Aligned region: 52..327
Protein Sequence: 602 a.a.     [Download]
>gi|146301004|ref|YP_001195595.1| Rhs element Vgr protein [Flavobacterium johnsoniae UW101]
MAHFSEQVHITIGSFTQNVVYYDLKLSQKMADHHHFSFVWQYTGKAVINPADQAKALRSYLGDEVIFTFK
SLTGIRLMSKGIITELSSIDVDGSPAGLHVSGVSHSIVIDDMKKSRTFKDRSMDDIVLGIFAEGPGEFYQ
RDSIKSTYLKEFKNLLQYNETSFEFLKRIAARYGQWFYFDGMRMQFGQTKSSQTKLINGASLHSFKIQAN
MASHKISLNGYDYKNVATFRESAPKTSSGSKDSFAAIVGYNQGTVANSDLNNGAYTANATNKDELDEMIK
LQTAGSDANSVYYSGISYFPIGLGQVFTIVNQTVAHELIAIEVVHHSQVHGNYSCEFKAIPADVSAPHYT
NVFVYGKAETQPAQVKDNNDPEGLGRVRVEFYGASGTAVTDWIRMVQPYSGSGKGFYFVPEIGEEVLIGF
EGNNVQNPYVIGAQYNGQDSSGYADAQNNIKAIHTRSGHVIKFTEDESILIADKNGNEILLDTVGGNITI
TANNTIDLNAQNINLNASQNITANAGMNITESAGADKMSIVGMMLNTTVGGDHMLNVTGNFMENIEGNLE
SHTAKERQEVGVKGIDTSSEGGINKHSKKEMQINSAEKSKSY
 
Nucleotide Sequence: 1809 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3901652-3899844 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGGCACATTTTTCAGAACAAGTACATATAACTATAGGAAGTTTTACCCAAAACGTTGTTTATTATGATT
TAAAGCTATCTCAAAAAATGGCCGATCATCATCATTTTTCTTTTGTTTGGCAATATACAGGTAAAGCCGT
AATTAACCCGGCAGATCAGGCTAAGGCTCTTAGAAGCTATCTTGGAGACGAAGTAATTTTTACTTTTAAA
AGTCTTACTGGGATCAGATTAATGAGCAAAGGTATAATTACTGAACTTTCATCGATTGATGTTGATGGAA
GTCCGGCAGGATTACACGTTTCTGGTGTAAGTCACAGTATTGTTATTGATGATATGAAAAAATCAAGAAC
ATTTAAAGACCGCAGTATGGATGATATCGTATTGGGGATTTTTGCTGAAGGACCGGGAGAATTTTATCAA
AGAGATTCTATTAAATCGACTTATCTTAAAGAATTTAAAAATCTTTTACAATATAACGAAACTAGTTTTG
AATTTTTAAAAAGAATAGCAGCACGTTATGGACAATGGTTTTATTTTGACGGAATGCGTATGCAGTTCGG
ACAGACAAAAAGCAGCCAGACCAAGCTTATAAATGGAGCTTCATTACACAGCTTTAAGATACAAGCTAAT
ATGGCTTCACATAAAATTTCGCTGAACGGTTATGATTATAAAAATGTAGCAACTTTTCGTGAGTCAGCAC
CTAAGACTTCATCTGGAAGTAAAGACAGCTTTGCCGCTATTGTAGGTTATAATCAAGGAACTGTAGCAAA
TTCTGATTTAAATAATGGGGCTTATACCGCAAATGCCACAAACAAAGACGAACTTGATGAAATGATAAAA
CTGCAGACTGCGGGCAGTGATGCCAACAGTGTTTATTACAGCGGTATTTCTTATTTTCCAATTGGTCTTG
GACAGGTATTTACAATAGTAAACCAAACAGTAGCACATGAATTAATTGCTATTGAAGTTGTACATCATTC
TCAGGTGCATGGAAATTATTCTTGTGAGTTTAAAGCAATTCCTGCAGATGTGTCAGCACCACACTATACA
AATGTATTTGTTTATGGCAAAGCCGAAACACAGCCTGCACAAGTAAAAGATAATAATGATCCTGAAGGAT
TAGGACGTGTAAGAGTAGAATTTTATGGTGCAAGCGGTACAGCAGTTACAGATTGGATAAGAATGGTGCA
GCCTTATTCTGGTTCAGGAAAAGGATTTTATTTTGTTCCTGAAATCGGAGAAGAAGTTTTAATTGGTTTT
GAAGGCAATAACGTCCAGAATCCTTATGTAATTGGTGCGCAGTATAACGGACAAGATTCAAGTGGTTATG
CAGATGCACAGAATAACATTAAAGCGATTCATACGAGAAGCGGTCATGTAATAAAATTCACAGAAGATGA
GAGCATCTTAATTGCTGATAAGAACGGTAATGAGATACTATTGGATACTGTTGGAGGTAACATAACTATT
ACAGCAAACAACACCATTGATCTAAACGCACAAAACATCAATCTTAATGCTTCTCAAAATATTACTGCTA
ATGCAGGAATGAATATTACAGAAAGTGCCGGAGCCGACAAAATGAGTATTGTAGGTATGATGCTTAATAC
TACTGTAGGAGGTGATCATATGCTTAATGTTACAGGAAACTTCATGGAAAACATTGAAGGAAATCTTGAA
TCTCATACGGCTAAAGAAAGACAGGAAGTTGGAGTTAAAGGAATTGATACAAGCAGTGAAGGAGGGATAA
ATAAACACTCTAAAAAAGAAATGCAAATTAACAGCGCCGAAAAATCTAAATCTTACTAA