SecReT6
Protein ID: 146301005
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3261
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3901691..3902086 [-]
Producthypothetical protein
NoteHcp
UniProt IDA5FET7
KEGG IDfjo:Fjoh_3261
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 131 a.a.     [Download]
>gi|146301005|ref|YP_001195596.1| hypothetical protein Fjoh_3261 [Flavobacterium johnsoniae UW101]
MSFLSKLHIDGEEYNVLEFNIGFKQEIDTTSKPTGNAKGGVIRMIIEASQNSHFLSWMLNGDLTKDGKIV
FYRRDALSKMKELTFTKAFCVGYDEQFTSTTEIPMRITMELVAKELTFGDAKFSNNWIALD
 
Nucleotide Sequence: 396 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3902086-3901691 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGAGTTTTTTATCTAAATTACATATAGACGGAGAAGAATATAATGTTCTTGAATTTAATATTGGTTTTA
AACAAGAAATTGATACAACAAGTAAACCTACCGGTAATGCAAAAGGCGGGGTTATAAGAATGATTATTGA
AGCAAGTCAGAATAGCCATTTTTTATCATGGATGTTAAATGGTGATTTAACCAAAGACGGAAAAATTGTT
TTTTACAGAAGAGATGCTTTAAGTAAAATGAAAGAACTTACGTTTACTAAGGCATTTTGTGTCGGTTATG
ATGAACAGTTTACAAGCACTACCGAAATACCAATGAGAATTACTATGGAGCTAGTAGCAAAAGAATTGAC
TTTTGGCGACGCTAAATTCTCAAACAATTGGATTGCTTTAGATTAA

Protein ID: 146301006
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3262
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3902237..3902623 [-]
Producthypothetical protein
NoteHcp
UniProt IDA5FET8
KEGG IDfjo:Fjoh_3262
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|146301006|ref|YP_001195597.1| hypothetical protein Fjoh_3262 [Flavobacterium johnsoniae UW101]
MSFLTSLTVAGKDYKVLNVSYDLAQETDASGRPSTVTRGGRIMIEVESTGSTELFEWMTNNFERKDGSVK
FIKRDSNATLKELKFTEAYMVKYKENFDHNSENPLTETFMISARKISMGGGEFDNAWV
 
Nucleotide Sequence: 387 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3902623-3902237 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGTCGTTTTTAACATCATTAACAGTAGCAGGAAAAGATTACAAAGTATTAAACGTAAGTTATGATTTAG
CTCAAGAAACAGATGCTTCTGGGCGTCCATCTACGGTAACACGCGGAGGAAGAATCATGATCGAAGTTGA
ATCAACTGGAAGTACTGAATTATTTGAATGGATGACTAACAATTTCGAAAGAAAAGACGGGTCAGTAAAA
TTCATCAAACGTGATTCAAATGCTACTTTAAAAGAGCTAAAGTTTACAGAGGCTTACATGGTTAAGTACA
AAGAAAACTTTGATCATAACAGTGAAAATCCATTAACTGAAACTTTTATGATTTCTGCTCGTAAAATTTC
GATGGGTGGAGGAGAATTTGATAATGCTTGGGTATAA