SecReT6
Protein ID: 146301007
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3263
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3902805..3903236 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA5FET9
KEGG IDfjo:Fjoh_3263
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.20E-10, Aligned region: 23..126
Protein Sequence: 143 a.a.     [Download]
>gi|146301007|ref|YP_001195598.1| GPW/gp25 family protein [Flavobacterium johnsoniae UW101]
MKGAFYKLPIDFNSVMQKKELEKTSIEHSIAQQIILLATTTFGECKFDETFGSKIWEIDFDLLMNENTLK
EIISKTMKQSLLFHEKRIKVNELKVELSETMYLVDDVSRAKKKVDIIIEATIKSTNRDFDFRGYFFVGPL
SYK
 
Nucleotide Sequence: 432 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3903236-3902805 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGAAAGGAGCATTTTACAAACTGCCTATAGACTTTAACAGCGTCATGCAAAAAAAGGAGCTGGAAAAAA
CATCAATAGAACACTCTATCGCACAGCAGATTATTTTATTGGCTACAACCACATTTGGAGAATGTAAGTT
TGATGAAACGTTTGGCTCAAAAATCTGGGAGATTGATTTTGATTTGCTGATGAATGAAAATACCCTCAAA
GAAATCATTTCAAAAACAATGAAACAATCGCTTCTTTTTCATGAAAAAAGAATAAAAGTAAATGAACTGA
AGGTAGAATTATCTGAAACAATGTATCTGGTTGATGATGTGAGCAGAGCTAAAAAGAAAGTTGATATTAT
AATTGAAGCCACTATTAAAAGTACAAACAGAGATTTTGATTTTAGAGGCTATTTTTTCGTTGGGCCTTTA
TCATATAAATAG