SecReT6
Protein ID: 146301010
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3266
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3904650..3906020 [-]
Producthypothetical protein
NoteTssC
UniProt IDA5FEU2
KEGG IDfjo:Fjoh_3266
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-14, Aligned region: 120..432
Phage_sheath_1 [PF04984], Evalue: 5.50E-05, Aligned region: 112..150
Phage_sheath_1 [PF04984], Evalue: 5.50E-05, Aligned region: 297..437
Protein Sequence: 456 a.a.     [Download]
>gi|146301010|ref|YP_001195601.1| hypothetical protein Fjoh_3266 [Flavobacterium johnsoniae UW101]
MSSKEAYKGDLDTAVLEPKAVKGISIEKNVEKLAKYGGFDLLEMAIEGVQNLNPDRKARRKIFLGEVNKA
KERETLLKTLELWSSVLSNNEALTDMVAQSEDKCKESEALLQKNLAKAVEDTREIEAAYRTLALFFKNTE
SDKVKNVTIVNAELDQLKDLDNTRFIDAIHSELVDNYDRLDLKNNYGILVIPGYLGSNKVIEKWAKIAHE
NKVMLVTDFEHLDEPDDVMEMFDAASLTGGDVYRSNVIMTCNWLVGRGRFDQIGENEDLHVAPSAALAGK
IYKTLMSQVTAGKKFGGINEVDGVKFDLKKSEIANLENLGLVPMVNEYGKVMAFSAKTLFSGDNLGLQTY
SVVRVFDYVTKVLMDFLNRRAFENFTAKTRKEIMNQIVAFLDGITGPDKLIENFEIRRFEQDPIQKDRIY
MDIHMKPYFPAKNFLIKMDGHKGDDGTEWDTDYEQK
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3906020-3904650 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGTCAAGCAAAGAAGCATATAAAGGTGATCTTGATACAGCAGTATTAGAACCAAAAGCAGTAAAAGGAA
TTTCAATTGAAAAAAATGTTGAAAAACTGGCTAAATACGGCGGTTTTGATTTATTAGAAATGGCAATTGA
AGGAGTTCAAAACCTTAACCCGGATAGAAAAGCAAGAAGAAAAATCTTTTTAGGTGAAGTAAACAAAGCA
AAAGAAAGAGAAACTCTTTTAAAGACTTTAGAACTTTGGTCTTCAGTTTTAAGCAATAATGAAGCTTTGA
CTGATATGGTGGCACAAAGTGAAGATAAATGCAAAGAATCTGAAGCTTTGCTTCAAAAAAACCTTGCTAA
AGCTGTTGAAGATACAAGAGAAATTGAAGCTGCTTACAGAACACTGGCTTTATTCTTTAAAAACACAGAA
TCTGACAAAGTAAAAAATGTTACAATTGTAAACGCAGAATTAGATCAGTTAAAAGACCTTGATAACACTC
GTTTTATTGATGCAATTCACTCAGAATTAGTTGATAATTACGATCGTTTAGATCTTAAAAATAACTACGG
TATTTTGGTAATTCCAGGATATTTAGGATCTAACAAAGTGATTGAAAAATGGGCAAAAATTGCGCATGAA
AACAAAGTAATGTTAGTTACAGATTTCGAACATCTTGATGAACCGGATGATGTAATGGAAATGTTTGATG
CTGCTTCATTGACTGGAGGAGATGTTTATCGTTCTAACGTAATCATGACTTGCAACTGGCTTGTTGGCCG
CGGCAGATTTGATCAAATTGGAGAAAACGAAGATTTACACGTTGCGCCTTCGGCTGCATTAGCAGGAAAA
ATATACAAAACATTAATGTCTCAGGTTACTGCAGGTAAGAAATTTGGAGGAATTAATGAAGTTGACGGAG
TGAAATTTGATCTTAAGAAAAGCGAAATCGCTAATCTTGAAAACTTAGGATTAGTTCCGATGGTAAATGA
ATACGGAAAAGTAATGGCTTTTTCTGCTAAAACATTATTCAGCGGAGATAATTTAGGATTGCAAACGTAC
TCTGTAGTTCGTGTTTTTGATTATGTGACTAAAGTATTAATGGATTTCCTTAATCGTCGTGCTTTCGAAA
ACTTTACTGCTAAAACACGTAAAGAGATTATGAATCAGATCGTTGCTTTCCTTGACGGAATCACTGGTCC
GGATAAATTAATTGAGAATTTTGAAATCCGCAGATTTGAACAAGATCCAATTCAAAAAGACAGAATTTAT
ATGGATATCCATATGAAACCTTATTTCCCTGCTAAAAACTTCCTTATTAAAATGGATGGTCACAAAGGTG
ACGACGGAACAGAATGGGATACAGATTACGAACAAAAATAA