SecReT6
Protein ID: 146301011
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3267
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3906041..3906490 [-]
Producthypothetical protein
NoteTssB
UniProt IDA5FES8
KEGG IDfjo:Fjoh_3267
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 149 a.a.     [Download]
>gi|146301011|ref|YP_001195602.1| hypothetical protein Fjoh_3267 [Flavobacterium johnsoniae UW101]
MLSNYGIGGNEVKIDADEAITAIPQNRTLVAQKLTVDAPVKPELVEGITSIEKAFEHFKPEVKVNFETAD
GATKVEPLNFKNLGDFGIKGITTQSSFLSDLETEKDQYQKIIRQLKSNKILKAALEDGEAKQALLESLGA
LINELKENK
 
Nucleotide Sequence: 450 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3906490-3906041 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGTTGTCAAACTATGGAATTGGAGGTAATGAAGTAAAAATTGATGCAGATGAAGCGATCACTGCAATCC
CTCAGAACAGAACACTTGTTGCTCAAAAATTAACAGTAGATGCTCCTGTAAAACCAGAATTGGTAGAAGG
AATTACAAGTATCGAAAAAGCATTTGAACATTTTAAACCAGAAGTAAAAGTAAATTTTGAAACTGCTGAT
GGTGCAACTAAAGTTGAGCCTTTAAACTTTAAAAACTTAGGTGATTTTGGTATAAAAGGAATTACAACAC
AAAGCAGTTTTTTATCTGATCTTGAAACAGAAAAAGATCAATATCAAAAAATTATCCGTCAGTTAAAATC
AAATAAGATTTTAAAAGCGGCTTTAGAAGACGGAGAAGCAAAACAGGCTTTGTTAGAAAGTCTTGGAGCA
CTGATCAACGAGTTAAAAGAAAACAAATAA