SecReT6
Protein ID: 146301012
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3268
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3906545..3907057 [-]
Producthypothetical protein
NoteTssO
UniProt IDA5FES9
KEGG IDfjo:Fjoh_3268
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 170 a.a.     [Download]
>gi|146301012|ref|YP_001195603.1| hypothetical protein Fjoh_3268 [Flavobacterium johnsoniae UW101]
MEVLNKQERQKAFIAFLIAFTLTFCVMLIAVSFNFYMPVAENKMLKAENEMMKREYDYQTNFSVKIDSIR
MTIDSINSPKVDNDFQQRLANVMIANIYQKVPKDTTENKKLYNNVILAYKNIIDYKKQIRSLTHNSHLID
SLNQSAKTYKEELEKVSRDLDVCRQIYQNQ
 
Nucleotide Sequence: 513 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3907057-3906545 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGGAAGTATTAAATAAACAAGAACGCCAGAAAGCATTTATCGCTTTTTTAATTGCCTTTACCCTGACAT
TCTGTGTTATGCTGATTGCAGTTTCGTTCAACTTTTATATGCCCGTGGCAGAAAATAAAATGTTGAAAGC
AGAAAATGAAATGATGAAAAGAGAATACGATTATCAAACTAATTTTTCGGTAAAAATTGACAGTATCAGA
ATGACAATAGACTCAATCAATTCGCCAAAAGTTGATAATGATTTTCAGCAGCGTCTGGCAAATGTTATGA
TTGCGAATATTTATCAAAAAGTGCCAAAAGACACAACTGAAAACAAAAAATTATATAACAATGTTATTCT
GGCCTACAAGAATATTATTGATTATAAAAAACAAATTAGAAGCCTTACACACAATTCGCACTTAATAGAC
AGTTTGAACCAGTCGGCTAAAACATACAAAGAAGAATTAGAAAAAGTAAGCAGAGATCTGGATGTATGCC
GTCAGATTTATCAAAATCAATAA