SecReT6
Protein ID: 146301013
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3269
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3907083..3908252 [-]
Producthypothetical protein
NoteTssK
UniProt IDA5FET0
KEGG IDfjo:Fjoh_3269
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 0.00033, Aligned region: 73..207
Protein Sequence: 389 a.a.     [Download]
>gi|146301013|ref|YP_001195604.1| hypothetical protein Fjoh_3269 [Flavobacterium johnsoniae UW101]
MIEKLNHFPVNWIDGMKINKSHFLSIQDNVSELVNDAIGIHTTPISYGLLDSGNQNKEATKITLGIDNHK
LLRVRVEECHAITPNGSRIEISKSNTDTLDLQVPYPEDTYEIKDGEQLVLLACISVNSKKRIPFGEPDPD
EVPPRYPYTQPEYKLHLIKAEEFRSGIGYGGFYLAIGKVLIGDTTVLDEDYIPPSVTVACHPKLVDIQAQ
IARSFGQIEIYSVQISQKINRGQQAGVLPQTVMQLADNTGYYLGSCLTQFRWFSMHQHPASMLSTVVAFA
RVMKNFIDSKSGAGKEELLNYFAEWCDISQGDLEIMFTTLINAGYDHVHIDKTATLVINALTRIEKLFET
LNKLDYIGKKKENIELFVAETEKKDIVHNPKRHGFFIKD
 
Nucleotide Sequence: 1170 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3908252-3907083 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGATAGAAAAATTAAATCATTTTCCCGTAAACTGGATTGATGGGATGAAGATAAATAAGAGTCATTTTT
TATCTATTCAGGACAACGTTTCTGAGTTGGTAAATGATGCAATTGGTATTCATACCACGCCTATAAGTTA
TGGTCTGCTGGATTCTGGAAACCAAAATAAAGAGGCCACAAAAATCACCTTAGGAATTGATAATCACAAA
CTGCTTCGTGTTCGTGTAGAAGAATGCCACGCCATAACACCAAACGGATCCAGAATTGAAATCAGTAAAA
GTAATACTGATACATTAGACCTTCAGGTTCCGTATCCTGAAGATACTTATGAAATAAAAGACGGCGAACA
ATTGGTTTTATTGGCCTGTATATCGGTTAATTCAAAAAAGAGAATCCCTTTTGGCGAGCCAGATCCAGAT
GAAGTACCGCCAAGATATCCGTACACACAGCCAGAATACAAACTTCATTTAATTAAAGCCGAAGAATTCC
GTTCAGGAATTGGATATGGAGGTTTCTATCTTGCTATTGGTAAAGTTCTTATTGGAGATACAACAGTTTT
AGATGAAGATTATATTCCGCCTTCTGTAACAGTGGCTTGTCATCCAAAATTAGTAGATATACAAGCACAA
ATTGCACGTTCTTTTGGTCAAATTGAAATTTACTCAGTTCAGATTTCTCAAAAAATAAACAGAGGACAAC
AGGCAGGAGTTTTGCCTCAAACAGTAATGCAGCTGGCAGATAATACAGGATATTATTTAGGAAGCTGTTT
AACGCAATTCCGCTGGTTTTCAATGCACCAGCATCCAGCTTCAATGTTAAGTACGGTTGTAGCATTTGCC
AGAGTGATGAAGAATTTTATCGATTCAAAATCGGGAGCTGGAAAAGAAGAGCTGCTAAATTATTTTGCCG
AATGGTGTGATATTTCACAAGGAGATCTTGAAATAATGTTTACCACTCTTATAAATGCCGGTTACGATCA
CGTGCATATTGATAAAACTGCTACGCTTGTAATAAATGCTTTAACGAGAATAGAGAAACTATTCGAAACA
CTGAATAAACTGGATTACATCGGTAAGAAAAAAGAAAACATCGAATTGTTTGTTGCCGAAACAGAGAAAA
AAGACATCGTTCATAATCCAAAACGTCACGGTTTCTTTATAAAAGATTAA