SecReT6
Protein ID: 146301021
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3277
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3916691..3917662 [-]
Producthypothetical protein
NoteTssN
UniProt IDA5FER9
KEGG IDfjo:Fjoh_3277
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 323 a.a.     [Download]
>gi|146301021|ref|YP_001195612.1| hypothetical protein Fjoh_3277 [Flavobacterium johnsoniae UW101]
MVKKHLLALIDIRLIVFLVVIIAVSFILTMVFSDKIKEFAVQYKRKFYIYVFSFVLIYALVGFLGYNKLF
TELSDEFRFYQIASLLFGILNVYLYRWYFNEFNLKGVVGIELLFSLLITLYSSVLFVIIYTALNGIALTF
LMCSHFLVFIVPTGVYAVFNYMMQIPPKEYVTWKIPERKNPFPEIENVEMKDLLLITLLIQKKETDTKYT
SLRSKGPVRIDFGALFYHTVSGYNEHNADSKIDLKENGENCSWVFFLQPKWYQTAKYVDAKYTLSMNGIT
ENSVIICKRQKIKKVNQTKKAEGKGEDFMFEPKVEKKEKEAAV
 
Nucleotide Sequence: 972 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3917662-3916691 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGGTAAAAAAGCATTTATTAGCCCTTATTGATATTAGGCTTATTGTATTTTTAGTAGTAATTATAGCGG
TAAGTTTTATACTTACCATGGTATTCAGCGATAAAATAAAAGAATTTGCGGTACAGTATAAAAGAAAGTT
TTACATCTATGTTTTTTCATTTGTATTGATTTATGCCCTGGTTGGTTTTTTGGGCTATAATAAATTATTT
ACAGAGTTGTCAGACGAGTTTCGATTTTATCAAATTGCATCACTGCTATTCGGAATCCTTAATGTTTACT
TGTATAGATGGTATTTTAATGAGTTTAATTTAAAAGGCGTTGTAGGTATCGAATTATTGTTTTCACTTTT
AATAACACTTTATTCAAGTGTATTATTTGTGATTATTTATACTGCCTTAAACGGGATTGCACTGACGTTT
TTAATGTGTTCTCATTTCTTGGTATTTATAGTACCGACAGGCGTTTATGCAGTTTTTAACTATATGATGC
AGATACCTCCGAAAGAATATGTTACATGGAAAATTCCGGAAAGAAAAAATCCCTTTCCTGAGATTGAAAA
CGTTGAAATGAAAGATTTATTGTTGATTACCCTATTAATTCAGAAAAAAGAAACCGATACAAAATATACT
TCTTTAAGATCCAAAGGTCCAGTAAGAATTGATTTTGGTGCACTGTTTTATCATACGGTTTCAGGATATA
ATGAACATAATGCCGATAGTAAAATTGATTTAAAAGAAAACGGCGAAAATTGCAGCTGGGTATTCTTTTT
ACAGCCAAAATGGTATCAAACGGCAAAATATGTAGATGCAAAATATACTTTGAGCATGAATGGTATTACT
GAAAACTCAGTTATCATTTGTAAAAGACAAAAGATTAAAAAAGTTAATCAAACAAAAAAAGCAGAAGGAA
AAGGAGAAGATTTTATGTTTGAACCAAAGGTTGAAAAGAAGGAAAAAGAGGCTGCAGTTTAA