SecReT6
Protein ID: 146301022
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3278
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3917665..3918609 [-]
Producthypothetical protein
NoteTssG
UniProt IDA5FES0
KEGG IDfjo:Fjoh_3278
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-06, Aligned region: 215..312
Protein Sequence: 314 a.a.     [Download]
>gi|146301022|ref|YP_001195613.1| hypothetical protein Fjoh_3278 [Flavobacterium johnsoniae UW101]
MERKSKKSLEDLAYEIENISYDIRAEVIANELLENKAVVQDEITISNHGQFSRAYRSDILGAAIQDDNYD
KQEYLNIRLSRDSMYDALPEGFVHSLTENNSDKSVKQMIREHKHQKKQEAEARVFFTPFENEIFHYRTKI
ESVERNFLYKLNGSKPLDFFYDFWGLSHIYPEILVSKFIQLLPYAYKIVGDIDLACNCLSSIIEEKVTYT
TTSSKEYSEEAEQIKLGENRLGVDFITGKDYMDYSMNLRIEIGPIMNKPYQHYLKNGDIKIFIDCFCEHF
FPMEVEVKTVLLINEETEEFNFSKEPVLGYTTRI
 
Nucleotide Sequence: 945 bp     [Download]
>gi|146297766|ref|NC_009441.1|:c3918609-3917665 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGGAAAGAAAAAGTAAAAAAAGCCTTGAAGATCTTGCGTACGAAATTGAAAATATTTCGTATGATATTA
GAGCGGAAGTGATTGCTAATGAGCTTCTTGAAAACAAAGCTGTGGTTCAGGATGAAATTACGATTTCGAA
TCACGGACAGTTTTCACGTGCCTACAGAAGCGATATTCTGGGAGCGGCAATTCAGGATGATAATTACGAC
AAACAAGAATATCTAAATATACGCTTATCTCGAGACAGTATGTATGACGCACTTCCGGAAGGTTTTGTGC
ATAGTCTGACCGAAAATAACTCTGATAAATCTGTAAAACAGATGATAAGGGAGCATAAACACCAGAAAAA
GCAAGAGGCTGAAGCACGTGTTTTTTTTACTCCTTTTGAAAACGAAATTTTTCATTATCGGACTAAAATT
GAAAGTGTTGAAAGGAATTTTTTGTATAAGCTGAACGGGAGTAAACCGTTAGATTTTTTCTATGATTTTT
GGGGTTTATCACACATTTATCCAGAGATTTTAGTTTCAAAATTTATTCAGTTACTGCCGTATGCCTACAA
GATAGTTGGAGATATTGATCTTGCCTGTAATTGTTTATCAAGCATTATAGAAGAAAAAGTAACCTATACA
ACAACAAGTTCTAAAGAATACAGCGAAGAAGCTGAGCAGATAAAGCTGGGTGAAAACAGGTTAGGAGTCG
ATTTTATTACCGGAAAAGATTATATGGATTATTCTATGAATTTAAGGATAGAAATAGGTCCTATAATGAA
CAAACCTTATCAGCATTACCTTAAAAACGGCGATATAAAAATATTTATAGATTGTTTTTGCGAACATTTT
TTTCCAATGGAAGTAGAAGTAAAAACAGTGTTATTGATTAATGAAGAAACAGAAGAGTTTAATTTTAGTA
AAGAACCTGTGTTAGGGTATACAACACGAATTTAG