SecReT6
Protein ID: 146301024
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3280
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3919581..3920633 [+]
ProductPKD domain-containing protein
NoteTssP
UniProt IDA5FES2
KEGG IDfjo:Fjoh_3280
PDB IDNA
Domain hit(s) vs Pfam PKD [PF00801], Evalue: 5.30E-13, Aligned region: 60..97
PKD [PF00801], Evalue: 5.30E-13, Aligned region: 126..185
Protein Sequence: 350 a.a.     [Download]
>gi|146301024|ref|YP_001195615.1| PKD domain-containing protein [Flavobacterium johnsoniae UW101]
MNQKNIDIRVVFFFAILLLAGIIAFIVQLFNHVDCDDAKFYIFADHSQSEESIEFYDKTPNAKSWIWDFG
DGSEKDVRKHTFHIYKNPGKYYVSLTINGNCTHTKEITIKDKFAADKIGTPKIIVPKTITVGQPAYFKSI
SDDARTWEWAFGENKGIDETSSNPVYSFITPGEKTITLVINGDFSRVAKKIIYVHPRVIKKTNPLDVSSY
EFEKKAEAFALPRGPVKKDPLEEMLQYVPVAPKAKTVKDTVATTKKAPKMSEDQFEILFKKVAEGSKVKD
DFAEFLCDDLDIPVVKNDKDLLTFAQLCASVKGKKIKIESIRLNKDKQTNCIKGLNISYKVKKYLVWSKD
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|146297766|ref|NC_009441.1|:3919581-3920633 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGAATCAAAAAAATATTGATATCAGGGTTGTGTTTTTTTTCGCAATTCTCTTATTAGCTGGAATCATTG
CATTTATAGTGCAGCTTTTTAATCATGTCGACTGTGATGATGCTAAATTTTATATTTTTGCAGACCATTC
TCAATCCGAAGAATCGATTGAGTTTTACGACAAAACTCCAAACGCAAAATCATGGATTTGGGACTTTGGA
GACGGATCAGAAAAAGATGTCAGAAAACACACTTTTCACATCTATAAAAATCCGGGAAAATACTATGTTT
CTTTAACAATAAACGGTAATTGCACCCATACAAAAGAGATCACGATAAAGGATAAATTTGCTGCAGATAA
AATAGGCACTCCAAAAATTATTGTACCCAAAACTATTACTGTTGGACAGCCCGCTTATTTTAAATCAATT
TCTGATGATGCCAGAACCTGGGAATGGGCATTTGGTGAAAATAAAGGCATTGATGAAACCTCTTCTAATC
CTGTTTACAGCTTTATCACGCCGGGCGAAAAAACGATTACTTTAGTCATAAACGGAGATTTCAGCCGTGT
GGCAAAAAAGATAATTTATGTGCATCCACGAGTTATAAAAAAGACGAATCCGCTGGATGTAAGCTCTTAT
GAATTTGAGAAAAAAGCCGAAGCTTTTGCTTTGCCAAGAGGACCTGTTAAAAAAGATCCGCTTGAAGAAA
TGCTGCAATATGTTCCGGTTGCTCCAAAAGCAAAAACTGTAAAAGACACTGTTGCCACGACTAAAAAAGC
ACCTAAAATGTCTGAAGACCAGTTTGAAATTTTGTTTAAAAAAGTAGCCGAAGGCAGTAAAGTTAAAGAT
GATTTTGCTGAGTTTTTATGTGATGATCTGGATATTCCGGTTGTAAAAAATGATAAAGATCTCTTAACTT
TTGCACAATTATGTGCTTCTGTAAAAGGAAAAAAAATAAAAATTGAGTCAATACGCTTAAACAAGGACAA
ACAAACTAACTGCATTAAAGGATTAAATATCAGCTATAAAGTAAAAAAATATCTGGTATGGTCTAAAGAT
TAA