SecReT6
Protein ID: 146301025
SecReT6 ID910
T6SS typeiii
Gene symbol-
Locus tagFjoh_3281
StrainFlavobacterium johnsoniae UW101
Repliconchromosome [GenBank: NC_009441] [Browse all T6SS(s) in this replicon]
Location [Strand]3920641..3923100 [+]
ProductATPase
NoteClpV
UniProt IDA5FES3
KEGG IDfjo:Fjoh_3281
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.10E-44, Aligned region: 199..275
AAA_2 [PF07724], Evalue: 6.10E-44, Aligned region: 552..714
AAA [PF00004], Evalue: 6.90E-19, Aligned region: 200..299
AAA [PF00004], Evalue: 6.90E-19, Aligned region: 558..677
ClpB_D2-small [PF10431], Evalue: 1.10E-18, Aligned region: 721..801
AAA_5 [PF07728], Evalue: 5.10E-14, Aligned region: 16..63
AAA_5 [PF07728], Evalue: 5.10E-14, Aligned region: 199..219
AAA_5 [PF07728], Evalue: 5.10E-14, Aligned region: 273..308
AAA_5 [PF07728], Evalue: 5.10E-14, Aligned region: 412..433
AAA_5 [PF07728], Evalue: 5.10E-14, Aligned region: 556..674
AAA_16 [PF13191], Evalue: 7.50E-13, Aligned region: 179..221
AAA_16 [PF13191], Evalue: 7.50E-13, Aligned region: 239..280
AAA_16 [PF13191], Evalue: 7.50E-13, Aligned region: 548..593
AAA_16 [PF13191], Evalue: 7.50E-13, Aligned region: 621..649
AAA_14 [PF13173], Evalue: 5.30E-09, Aligned region: 45..68
AAA_14 [PF13173], Evalue: 5.30E-09, Aligned region: 197..324
AAA_14 [PF13173], Evalue: 5.30E-09, Aligned region: 352..390
AAA_14 [PF13173], Evalue: 5.30E-09, Aligned region: 443..474
AAA_14 [PF13173], Evalue: 5.30E-09, Aligned region: 559..652
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 199..280
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 557..580
Sigma54_activat [PF00158], Evalue: 1.60E-08, Aligned region: 196..221
Sigma54_activat [PF00158], Evalue: 1.60E-08, Aligned region: 546..664
IstB_IS21 [PF01695], Evalue: 1.60E-05, Aligned region: 197..227
IstB_IS21 [PF01695], Evalue: 1.60E-05, Aligned region: 556..583
T2SE [PF00437], Evalue: 2.90E-05, Aligned region: 184..223
T2SE [PF00437], Evalue: 2.90E-05, Aligned region: 554..630
T2SE [PF00437], Evalue: 2.90E-05, Aligned region: 763..804
NACHT [PF05729], Evalue: 4.70E-05, Aligned region: 200..236
NACHT [PF05729], Evalue: 4.70E-05, Aligned region: 558..580
ABC_tran [PF00005], Evalue: 6.90E-05, Aligned region: 199..223
ABC_tran [PF00005], Evalue: 6.90E-05, Aligned region: 339..389
ABC_tran [PF00005], Evalue: 6.90E-05, Aligned region: 557..594
RNA_helicase [PF00910], Evalue: 0.00017, Aligned region: 200..223
RNA_helicase [PF00910], Evalue: 0.00017, Aligned region: 435..464
RNA_helicase [PF00910], Evalue: 0.00017, Aligned region: 557..578
DUF815 [PF05673], Evalue: 0.00018, Aligned region: 196..237
DUF815 [PF05673], Evalue: 0.00018, Aligned region: 344..371
DUF815 [PF05673], Evalue: 0.00018, Aligned region: 549..588
AAA_10 [PF12846], Evalue: 0.00028, Aligned region: 198..352
AAA_10 [PF12846], Evalue: 0.00028, Aligned region: 555..589
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 55..94
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 200..345
AAA_17 [PF13207], Evalue: 0.00033, Aligned region: 560..593
Arch_ATPase [PF01637], Evalue: 0.00038, Aligned region: 180..223
Arch_ATPase [PF01637], Evalue: 0.00038, Aligned region: 467..470
Arch_ATPase [PF01637], Evalue: 0.00038, Aligned region: 556..582
Arch_ATPase [PF01637], Evalue: 0.00038, Aligned region: 692..731
AAA_24 [PF13479], Evalue: 0.00055, Aligned region: 25..78
AAA_24 [PF13479], Evalue: 0.00055, Aligned region: 199..220
AAA_24 [PF13479], Evalue: 0.00055, Aligned region: 426..456
AAA_24 [PF13479], Evalue: 0.00055, Aligned region: 557..580
DUF258 [PF03193], Evalue: 0.00071, Aligned region: 173..221
DUF258 [PF03193], Evalue: 0.00071, Aligned region: 556..576
AAA_29 [PF13555], Evalue: 0.00084, Aligned region: 196..218
AAA_29 [PF13555], Evalue: 0.00084, Aligned region: 555..569
Mg_chelatase [PF01078], Evalue: 0.0011, Aligned region: 198..220
Mg_chelatase [PF01078], Evalue: 0.0011, Aligned region: 554..579
FtsK_SpoIIIE [PF01580], Evalue: 0.0019, Aligned region: 197..250
FtsK_SpoIIIE [PF01580], Evalue: 0.0019, Aligned region: 459..477
FtsK_SpoIIIE [PF01580], Evalue: 0.0019, Aligned region: 559..573
Zeta_toxin [PF06414], Evalue: 0.0026, Aligned region: 200..220
Zeta_toxin [PF06414], Evalue: 0.0026, Aligned region: 555..606
Sigma54_activ_2 [PF14532], Evalue: 0.003, Aligned region: 196..241
Sigma54_activ_2 [PF14532], Evalue: 0.003, Aligned region: 542..577
Torsin [PF06309], Evalue: 0.004, Aligned region: 197..263
Torsin [PF06309], Evalue: 0.004, Aligned region: 511..580
MobB [PF03205], Evalue: 0.0049, Aligned region: 199..226
MobB [PF03205], Evalue: 0.0049, Aligned region: 558..581
DUF87 [PF01935], Evalue: 0.0081, Aligned region: 202..223
DUF87 [PF01935], Evalue: 0.0081, Aligned region: 344..446
DUF87 [PF01935], Evalue: 0.0081, Aligned region: 559..589
AAA_25 [PF13481], Evalue: 0.0096, Aligned region: 47..71
AAA_25 [PF13481], Evalue: 0.0096, Aligned region: 200..225
AAA_25 [PF13481], Evalue: 0.0096, Aligned region: 557..581
Protein Sequence: 819 a.a.     [Download]
>gi|146301025|ref|YP_001195616.1| ATPase [Flavobacterium johnsoniae UW101]
MEEEKNVFSAELLSALEIAKKIAKTNLNKYYSASHLLKAVLNRDLSLLKRLEAMGKDVYYLDEWAEVRIE
EEPKTTHVLDAEPSDLIDEIIKEAESVRIALNEDEISLYAVIIALSSPGVGFNFDQMKSYPISRNELLED
QIVIPQTESGAKQEVKKGFLSKYCIHKNLEKNKKRIPAIGREAELNAIKEILCRFSKPNVLLIGDRGIGK
SILIDTLVQNVITNQVPDALNKVQLFELDLSSLIAGASYKGEIEDRLKNCIQELKQYPRAILIIEEIHIL
LDKNGGDSGVSNVLKGELAKGLNIIATSTIDEFSKRIEKEQGLSGMFEIVKLEESDDETLFRMIRESIKT
YQEHHKIQIDDETISESIRLSRRYLKEKSLPESAINLIDHTMSVLKTSGETFLNEKQSIINRLNLLKENT
SNLSEDQLIKEYNWFLVDLINKTTFLMDVDEQNEKRNFETSESILNYIENLIKTLEEKALDKRSHIEAFD
LSLIIAKKTGIPAGKLKEEEKQKLNNIEEVLNRRVIGQDHCIATVAGSILEARSGLSKAGQPIASFFFLG
PTGTGKTELAKSLAEFLFQDENAIIRFDMSEFKEEHSAALLYGAPPGYVGYEEGGLLVNKIRQKPYSIVL
FDEIEKAHPSVFDVFLQIMDEGKLHDRLGKEGDFSNAIILFTSNIGADHIVNTFNNGEIPTSGSLMEIMG
NYFRPEFLGRLTEIVPFAPISKENALKIFEIHLKKEFMDLLKNINIKVEIPMEAKLYLAENGYNAKYGAR
PIKSIIRSHLRRPLAKKIISGEVKDGDTISVTIENNEVKWVKEEFTAVN
 
Nucleotide Sequence: 2460 bp     [Download]
>gi|146297766|ref|NC_009441.1|:3920641-3923100 Flavobacterium johnsoniae UW101 chromosome, complete genome
ATGGAAGAAGAAAAAAACGTTTTCAGTGCAGAATTATTAAGCGCATTAGAAATTGCGAAGAAAATCGCTA
AAACCAATTTAAATAAATATTACTCGGCGTCACATTTGTTAAAAGCAGTTTTAAACAGGGATTTATCACT
CTTAAAACGTCTTGAAGCTATGGGCAAAGATGTTTATTATCTTGATGAATGGGCAGAAGTACGAATTGAA
GAAGAACCAAAAACTACTCATGTTCTTGATGCTGAGCCAAGTGATTTAATTGATGAGATTATAAAAGAGG
CCGAATCAGTACGTATAGCACTTAATGAAGATGAAATTAGTCTTTATGCCGTGATAATTGCTTTAAGTTC
TCCGGGTGTAGGTTTCAATTTCGATCAAATGAAGTCTTATCCTATCTCAAGAAATGAATTATTAGAAGAT
CAGATAGTTATTCCGCAAACTGAGAGTGGTGCAAAACAAGAAGTAAAAAAAGGTTTTTTAAGCAAATACT
GTATCCATAAAAATCTGGAGAAAAATAAAAAAAGAATTCCTGCAATTGGGCGTGAAGCCGAATTGAATGC
CATAAAAGAAATTCTCTGCCGATTCTCTAAACCTAATGTTCTGCTTATAGGCGACCGAGGCATTGGAAAA
TCGATTTTAATTGATACTCTTGTTCAAAATGTAATAACAAATCAGGTTCCGGATGCTTTAAACAAAGTAC
AGCTTTTTGAACTCGACTTATCTTCTCTTATTGCCGGAGCTTCATACAAAGGCGAAATTGAAGACCGTTT
AAAAAACTGCATTCAGGAATTAAAACAATACCCCAGAGCTATTTTAATTATTGAAGAAATTCATATTTTA
CTCGATAAAAACGGAGGAGATTCCGGCGTTTCAAATGTTCTTAAAGGCGAACTGGCAAAAGGATTAAATA
TTATCGCGACCTCAACAATCGATGAATTTTCAAAAAGAATTGAGAAAGAACAAGGACTTTCCGGAATGTT
TGAGATCGTTAAATTAGAAGAATCTGATGATGAGACTTTGTTCAGAATGATTCGCGAATCTATCAAAACC
TATCAGGAACATCATAAAATACAAATAGACGATGAAACCATTTCAGAATCTATCCGCTTATCCAGAAGGT
ATTTAAAAGAAAAAAGCCTTCCTGAATCTGCAATTAATCTGATCGATCATACGATGTCGGTTTTAAAAAC
TTCAGGAGAAACTTTTCTTAATGAAAAACAATCTATTATCAACAGATTAAATCTTTTAAAAGAAAATACC
AGCAATTTATCTGAAGATCAATTGATAAAAGAATACAATTGGTTTCTGGTTGATTTAATAAACAAAACAA
CATTTTTGATGGATGTTGATGAACAAAATGAAAAAAGAAATTTTGAAACATCAGAATCGATCTTAAATTA
TATTGAAAACCTGATTAAAACGCTTGAAGAAAAGGCACTTGATAAACGCTCTCATATTGAAGCTTTTGAT
TTGTCTTTGATTATTGCTAAAAAAACCGGAATTCCGGCAGGAAAACTTAAGGAAGAAGAAAAACAGAAAC
TAAACAATATTGAGGAAGTTCTAAACCGAAGAGTTATTGGACAGGATCATTGTATAGCAACGGTTGCAGG
CTCTATTTTAGAGGCAAGATCCGGATTAAGCAAAGCCGGACAGCCTATAGCATCTTTCTTTTTTCTTGGA
CCAACAGGAACGGGAAAAACAGAATTAGCCAAAAGTTTAGCCGAGTTTCTGTTTCAGGATGAAAATGCCA
TCATTAGATTTGATATGTCTGAGTTTAAAGAAGAGCATTCAGCAGCGCTTCTTTACGGTGCGCCTCCTGG
TTATGTAGGTTATGAAGAAGGCGGTCTGCTGGTGAACAAAATCAGACAAAAACCTTATTCTATTGTTTTA
TTTGACGAAATTGAAAAAGCACATCCTTCTGTTTTTGACGTATTCCTTCAAATTATGGACGAAGGAAAAC
TACATGATCGTTTAGGAAAAGAAGGTGATTTTTCGAATGCTATTATACTTTTTACCTCAAATATTGGGGC
AGATCATATTGTAAATACTTTTAATAACGGCGAAATTCCAACATCTGGTTCTTTAATGGAAATTATGGGG
AATTATTTCAGACCTGAATTTTTAGGACGTTTAACTGAAATAGTACCTTTTGCCCCTATCAGTAAAGAAA
ATGCATTGAAAATATTCGAAATCCATCTCAAAAAAGAGTTCATGGATTTATTAAAAAACATCAATATTAA
AGTTGAAATTCCCATGGAGGCTAAACTTTATCTTGCTGAAAACGGATATAATGCTAAATATGGTGCAAGA
CCAATCAAAAGTATTATCAGAAGTCATTTAAGAAGACCTTTGGCAAAAAAAATAATTTCAGGAGAAGTAA
AAGACGGCGATACAATTTCTGTTACCATAGAAAACAATGAAGTAAAATGGGTAAAAGAAGAATTTACCGC
TGTAAATTAA