SecReT6
Protein ID: 146305130
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0089
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]84279..85841 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA4XNE7
KEGG IDpmy:Pmen_0089
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 55..115
TPR_21 [PF09976], Evalue: 0.0096, Aligned region: 412..469
Protein Sequence: 520 a.a.     [Download]
>gi|146305130|ref|YP_001185595.1| unnamed protein product [Pseudomonas mendocina ymp]
MTYSSKLTAHYLNLAKSPINEGNFAGEDVRYSSEYEMLETELGKASSLHETGAIDWQKVREGSENLLTTQ
SKDLRAATWLTWGLFQRESFAGLQAGLNLLHYLCEHHWHELHPRKARTRTAAINWLLPRLEQALAEHVPI
SEQLPLFRRLAEHLHGLEAALSSHLGEDSPLLLPLCRRLDEQIKRASQGQAEPGAVGAAIAQVKQVATQI
ITGSGPIESEKDAHKALRSQQDAARPLCAWWLKNKATDLKPLRLARTLLWLPIESLPERNAEQITALRGL
PADKLASYKERFAQGAYADLLADLEASIARAPFWLDGQRLVWECLQELKAEQAMREVEIQLALFLQRVPG
LDELRFHDGVPFADAETRAWIGAHVLPHLQAPEVEKKPAASEQGATPPWEEALQQVLPGLRKDGLKAAVQ
QLKQGMSRARGGRERFFWQLTLARLCFAAKKYDLAKTQLESLDQTLQAAGLGEWEPDLALDVLRLLHHCC
ELLPQNHAVRDSKDEIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1563 bp     [Download]
>gi|146305042|ref|NC_009439.1|:84279-85841 Pseudomonas mendocina ymp chromosome, complete genome
ATGACGTACTCCAGCAAGCTCACCGCTCATTATCTCAATCTGGCTAAATCCCCTATTAATGAAGGGAACT
TCGCCGGTGAAGACGTGCGTTATTCCAGCGAATACGAAATGCTGGAAACCGAGCTGGGCAAGGCCTCCTC
GCTGCATGAAACCGGCGCCATCGACTGGCAGAAGGTGCGCGAGGGCAGCGAGAACCTGCTGACCACCCAA
TCCAAGGATCTGCGCGCCGCCACCTGGCTGACCTGGGGCCTGTTCCAGCGCGAATCCTTCGCCGGCCTGC
AGGCCGGTCTGAACCTGCTGCACTACCTCTGCGAACACCACTGGCACGAGCTGCACCCGCGCAAGGCGCG
GACCCGCACCGCCGCCATCAACTGGCTGCTGCCGCGCCTGGAACAGGCGCTGGCCGAACACGTGCCGATC
AGCGAGCAGCTGCCGCTGTTTCGCCGTCTGGCCGAACACCTGCACGGTCTGGAAGCCGCCCTGTCGAGCC
ACCTCGGCGAGGACTCGCCGCTGCTGCTGCCGTTGTGCCGCCGCCTCGACGAGCAGATCAAGCGGGCCAG
CCAGGGCCAGGCCGAGCCGGGCGCAGTCGGCGCCGCCATTGCCCAGGTCAAGCAGGTCGCCACCCAGATC
ATCACCGGCAGCGGTCCCATCGAAAGCGAGAAGGATGCCCACAAGGCCCTGCGCAGCCAGCAGGACGCCG
CCCGCCCGCTGTGCGCCTGGTGGCTGAAGAACAAGGCCACCGACCTCAAGCCGCTGCGCCTGGCGCGTAC
CCTGCTGTGGCTGCCCATCGAGTCGCTGCCCGAGCGCAACGCCGAACAGATCACCGCCCTGCGCGGCCTG
CCGGCCGACAAGCTGGCCTCCTACAAGGAACGTTTCGCCCAGGGCGCCTACGCCGACCTGCTCGCCGATC
TGGAAGCCAGCATCGCCCGCGCGCCGTTCTGGCTCGATGGCCAGCGCCTGGTCTGGGAATGCCTGCAGGA
GCTCAAGGCCGAGCAGGCCATGCGCGAAGTGGAAATCCAGCTCGCCCTGTTCCTGCAGCGCGTGCCCGGC
CTCGACGAGCTGCGCTTCCATGACGGCGTGCCCTTCGCCGATGCCGAGACCCGTGCCTGGATCGGTGCCC
ATGTGCTGCCGCACCTGCAGGCCCCGGAAGTGGAGAAGAAGCCTGCCGCCAGCGAGCAGGGCGCCACGCC
GCCCTGGGAAGAGGCGCTGCAGCAGGTGCTGCCCGGCCTGCGCAAGGACGGCCTGAAGGCCGCCGTGCAG
CAGCTCAAGCAGGGCATGTCGCGCGCCCGTGGCGGCCGCGAACGCTTCTTCTGGCAACTGACCCTGGCCC
GCCTGTGCTTCGCCGCGAAGAAGTACGACCTGGCCAAGACCCAACTCGAATCGCTCGACCAGACGCTGCA
GGCCGCCGGCCTCGGCGAGTGGGAACCCGATCTCGCCCTGGACGTGCTGCGCCTGCTGCACCACTGCTGC
GAGCTGCTGCCGCAGAACCATGCGGTGCGCGACAGCAAGGACGAGATCTATCGCAGGTTGTGCCACCTCG
ATCTCGAGGTGGTGCTGGAGTAA