SecReT6
Protein ID: 146305131
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0090
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]85896..86402 [+]
Producthypothetical protein
NoteTssB
UniProt IDA4XNE8
KEGG IDpmy:Pmen_0090
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-56, Aligned region: 5..159
Protein Sequence: 168 a.a.     [Download]
>gi|146305131|ref|YP_001185596.1| unnamed protein product [Pseudomonas mendocina ymp]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLMVLGDFTQRADDRKIEDRKPISIDKNSFDEVLAKQE
LNLTFAVPNRLQDEQTDDELAVQLRINSMKDFNPANLVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IESVLSDDDSRDRVLGELGLAAKDKLDS
 
Nucleotide Sequence: 507 bp     [Download]
>gi|146305042|ref|NC_009439.1|:85896-86402 Pseudomonas mendocina ymp chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCCAAGGAACGCATCAACGTCACCTTCAAACCCGCCACCGGCGGCG
CCCAGGAAGAAATCGAACTGCCCCTGAAGCTCATGGTGCTCGGCGATTTCACCCAGCGTGCCGACGATCG
CAAGATCGAAGACCGCAAGCCCATCAGCATCGACAAGAACAGCTTCGACGAAGTGCTGGCCAAGCAGGAA
CTGAACCTGACCTTCGCCGTGCCGAACCGTCTGCAGGACGAGCAGACCGATGACGAGCTGGCCGTGCAGC
TGCGCATCAACTCCATGAAGGACTTCAACCCCGCCAACCTGGTCGAGCAGGTACCGGAGCTGAAGAAGCT
GATGGAACTGCGCGACGCCCTGGTCGCCCTCAAAGGCCCGCTGGGCAACGCCCCGGCCTTCCGCAAGGCG
ATCGAAAGCGTGCTCTCCGACGACGACTCGCGCGATCGCGTGCTCGGCGAACTGGGCCTGGCCGCCAAAG
ACAAGCTGGATTCCTGA