SecReT6
Protein ID: 146305132
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0091
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]86428..87906 [+]
Producthypothetical protein
NoteTssC
UniProt IDA4XNE9
KEGG IDpmy:Pmen_0091
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.90E-194, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|146305132|ref|YP_001185597.1| unnamed protein product [Pseudomonas mendocina ymp]
MSTTSAAVESSHSAAELGILDRIIAETKLTPDDEAYDIAKRGVSAFIEELLKPQNENEPVKKAMVDRMIA
EIDAKLSRQMDEILHHPDFQALESSWRGLKLLVDRTNFRENIKLEILNASKQDLLDDFEDSPEIVQSGLY
KHIYTAEYGQFGGQPVGALIANYYFDPSAPDVKTLQYVASVACMSHAPFIASAGPKFFGLETFTGLPDLK
DLKDHFEGPQFTKWQSFREQEDARYVGLTVPRFLLRNPYDPEDNPVKTFVYKENVANSHEHYLWGNTAYA
FASRLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFIALTMR
KGSDNAAFFSANSAQKPKFFGISEEGKTAELNYKLGTQLPYMFIVNRLAHYLKVLQREQIGAWKERTDLE
LELNKWIRQYVADQENPSSEVRSRRPLRAAQVIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|146305042|ref|NC_009439.1|:86428-87906 Pseudomonas mendocina ymp chromosome, complete genome
ATGAGCACGACTAGCGCAGCCGTAGAAAGCAGCCACAGCGCCGCCGAACTCGGCATTCTCGACCGCATCA
TCGCCGAGACCAAACTGACCCCCGATGACGAGGCCTACGACATCGCCAAGCGCGGCGTATCGGCCTTCAT
CGAAGAGCTGCTCAAGCCGCAGAACGAAAACGAGCCGGTGAAGAAGGCCATGGTCGACCGCATGATCGCG
GAGATCGACGCCAAGCTCAGCCGGCAGATGGACGAGATCCTCCACCACCCGGACTTCCAGGCCCTGGAAT
CCTCCTGGCGCGGTCTCAAGCTGCTGGTGGACCGCACCAACTTCCGCGAGAACATCAAGCTGGAGATCCT
CAACGCCTCCAAGCAGGACCTGCTCGATGACTTCGAAGACAGCCCGGAAATCGTTCAGTCCGGCCTGTAC
AAGCACATCTACACCGCCGAGTACGGCCAGTTCGGTGGCCAGCCGGTCGGCGCCCTGATCGCCAACTACT
ACTTCGACCCGAGCGCTCCGGACGTCAAGACCCTGCAGTACGTCGCCTCGGTGGCCTGCATGTCCCACGC
CCCGTTCATCGCCTCGGCCGGCCCGAAATTCTTCGGCCTGGAAACCTTCACCGGCCTGCCGGACCTGAAG
GACCTCAAGGACCACTTCGAAGGCCCGCAATTCACCAAGTGGCAGAGCTTCCGCGAGCAGGAAGACGCCC
GCTACGTCGGCCTGACTGTACCGCGCTTCCTGCTGCGCAACCCGTACGATCCGGAAGACAACCCGGTGAA
GACCTTCGTCTACAAGGAAAACGTGGCCAACAGCCACGAGCACTACCTGTGGGGCAACACCGCCTACGCC
TTCGCCAGCCGTCTGACCGACAGCTTCGCCAAGTTCCGCTGGTGCCCGAATATCATCGGCCCGCAGAGCG
GTGGCGCGGTGGAAGACCTGCCGCTGCACCACTTCGAGAGCATGGGCGAGATCGAGACCAAGATCCCCAC
CGAGGTGCTGGTTTCCGACCGTCGCGAATATGAACTTGCGGAAGAGGGCTTTATCGCCCTGACCATGCGC
AAGGGCAGCGACAACGCCGCGTTCTTCTCCGCCAACTCGGCGCAGAAGCCGAAGTTCTTCGGCATCAGCG
AAGAAGGCAAGACCGCCGAGCTGAACTACAAGCTGGGCACCCAGCTGCCGTACATGTTCATCGTCAACCG
CCTGGCCCACTACCTGAAAGTGCTGCAGCGCGAGCAGATCGGCGCCTGGAAGGAGCGTACCGACCTCGAG
CTGGAACTGAACAAGTGGATCCGCCAGTACGTGGCCGACCAGGAGAACCCCAGCTCCGAAGTGCGTAGCC
GCCGTCCGCTGCGCGCCGCCCAGGTCATCGTCAGCGATGTCGAAGGCGAGCCGGGCTGGTACCGCGTCAG
CCTGAACGTGCGCCCGCACTTCAAGTACATGGGTGCCGATTTCACCCTGTCGCTGGTCGGCAAGCTGGAC
AAGGAATAA