SecReT6
Protein ID: 146305133
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0092
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]87913..88341 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA4XNF0
KEGG IDpmy:Pmen_0092
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-19, Aligned region: 25..116
Protein Sequence: 142 a.a.     [Download]
>gi|146305133|ref|YP_001185598.1| unnamed protein product [Pseudomonas mendocina ymp]
MNGYGSLFERLGGEAGQRAGWSREVAAMASVAAHLAKMLSTRAGSVQTLPDYGLPDLNDMRLSLHDSLQQ
ARIAIERFIEAYEPRLTQVRVISLPRTHDPLRQAFAIDAMLEMDGVRRQVSFSASLDGSGQVKVNPGASH
VR
 
Nucleotide Sequence: 429 bp     [Download]
>gi|146305042|ref|NC_009439.1|:87913-88341 Pseudomonas mendocina ymp chromosome, complete genome
ATGAACGGATACGGCAGCCTGTTCGAGCGTCTCGGTGGCGAGGCCGGCCAACGTGCCGGCTGGAGCCGCG
AGGTCGCCGCCATGGCCTCGGTGGCTGCCCATCTGGCCAAGATGCTCAGCACCCGTGCGGGCAGCGTGCA
GACGCTGCCCGACTACGGGCTGCCCGATTTGAACGATATGCGCCTGTCGCTGCACGACTCGCTGCAGCAG
GCGCGTATCGCCATCGAACGCTTTATCGAAGCGTACGAACCCCGTCTGACCCAGGTGCGCGTGATTTCCC
TGCCGCGCACCCATGATCCGCTGCGCCAGGCCTTTGCCATCGACGCGATGCTGGAGATGGATGGCGTCAG
GCGTCAGGTCAGTTTCTCCGCGAGCCTGGACGGCAGCGGTCAGGTCAAGGTCAACCCAGGAGCCTCACAT
GTCCGGTAA