SecReT6
Protein ID: 146305134
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0093
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]88331..89776 [+]
Producthypothetical protein
NotePAAR
UniProt IDA4XNF1
KEGG IDpmy:Pmen_0093
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-18, Aligned region: 2..57
PAAR_motif [PF05488], Evalue: 1.10E-18, Aligned region: 58..83
PAAR_motif [PF05488], Evalue: 1.10E-18, Aligned region: 75..90
DUF4150 [PF13665], Evalue: 0.0056, Aligned region: 2..14
DUF4150 [PF13665], Evalue: 0.0056, Aligned region: 25..47
DUF4150 [PF13665], Evalue: 0.0056, Aligned region: 52..97
FlgD_ig [PF13860], Evalue: 0.0059, Aligned region: 171..216
Protein Sequence: 481 a.a.     [Download]
>gi|146305134|ref|YP_001185599.1| unnamed protein product [Pseudomonas mendocina ymp]
MSGKPAARLGDPTACPIPGHGTNPIAAGSPDVLFDSLPAARMGDASACGGAMAGAVIPNVLINGKPAAVV
GSVGSHGNTVVAGSGTVLIGASGGGAAFSPVAPLSLVAAAASVINVLVPPAQAAEERALDYTIALQRGGN
RVLTPLRIPDYEEIGQGTTNNRETIDFQIRNRKQPADSLTLEVYDGETLLHSEADTAALLPTGEHQWQWD
GYDRSGVLDTRVLKSPNLLVRLTVKKGAEEQVSELRLDNSAAAAPWVDARVDRNAGSVEITLRPSFSDGG
VSGRNNQLTARTFDELKVLAKAGVEYYWSREGSRAGGIDKPIQTAKGAFQVKVIADVNAKPSAKNFPLIA
SIGDDFGRSTSFAMFKKIYHNLGMWAAANYPANFADEDFAHTAAHEVGHLILNEYGDGGLIPAYSWSHKS
TSTILTQAPVDNHPIPAAGEIDLMHYHSHSPRNYQDYWQRSIASENDVKGLLWLTRVKFDD
 
Nucleotide Sequence: 1446 bp     [Download]
>gi|146305042|ref|NC_009439.1|:88331-89776 Pseudomonas mendocina ymp chromosome, complete genome
ATGTCCGGTAAACCCGCAGCCCGCCTCGGCGATCCCACCGCCTGCCCGATTCCCGGCCACGGCACCAACC
CGATCGCCGCCGGCTCGCCCGACGTGCTGTTCGACAGTCTGCCCGCCGCGCGCATGGGCGATGCCTCCGC
CTGCGGCGGCGCCATGGCCGGCGCGGTGATTCCCAACGTGCTGATCAACGGCAAGCCGGCGGCGGTAGTG
GGCAGTGTGGGCAGTCATGGCAATACCGTGGTGGCTGGCTCCGGCACCGTGTTGATCGGCGCGAGTGGCG
GTGGGGCGGCGTTCAGCCCGGTTGCGCCGCTGTCGCTGGTGGCTGCTGCAGCTAGCGTCATCAATGTTCT
GGTGCCTCCGGCTCAAGCGGCCGAAGAGCGCGCGCTGGATTACACCATTGCTTTGCAGCGTGGAGGCAAT
CGTGTGCTCACGCCTCTGCGGATTCCCGATTACGAGGAAATTGGACAAGGCACAACGAACAATCGAGAGA
CCATCGATTTCCAGATCCGTAACCGCAAACAGCCGGCCGATAGCCTGACCCTGGAGGTATACGATGGCGA
GACGCTGCTCCATAGCGAAGCGGATACAGCGGCGCTGCTTCCGACAGGTGAGCACCAGTGGCAGTGGGAC
GGCTACGACCGATCTGGCGTTCTCGATACTCGTGTTTTGAAAAGCCCCAACCTGCTTGTGCGTCTGACCG
TGAAGAAAGGTGCTGAAGAGCAGGTATCGGAGCTGCGGCTGGACAATAGCGCTGCAGCCGCACCGTGGGT
CGATGCCCGCGTTGATCGCAACGCTGGCTCCGTCGAGATCACCCTGCGCCCCAGCTTCTCTGATGGTGGT
GTATCCGGCAGGAACAACCAATTGACGGCCCGCACATTCGATGAACTGAAGGTATTGGCCAAGGCGGGGG
TCGAATACTACTGGTCGCGTGAGGGCAGTCGTGCAGGCGGCATCGACAAGCCGATTCAGACAGCCAAAGG
CGCGTTTCAGGTGAAGGTCATCGCTGATGTGAATGCCAAGCCCAGCGCCAAGAATTTCCCGCTCATTGCT
TCAATCGGTGATGACTTCGGTCGTTCCACTAGTTTCGCGATGTTCAAAAAGATTTACCACAACTTGGGCA
TGTGGGCGGCTGCCAACTATCCCGCCAATTTTGCCGATGAGGATTTCGCGCACACCGCTGCGCATGAGGT
GGGTCACCTCATCCTCAACGAGTACGGCGATGGTGGCTTGATACCTGCGTACTCGTGGAGCCACAAGTCG
ACCTCCACGATCCTCACTCAGGCGCCTGTGGACAATCACCCCATTCCAGCGGCAGGGGAGATAGACCTTA
TGCATTACCACTCCCACAGCCCACGCAACTACCAGGACTATTGGCAGCGTTCCATCGCCTCGGAGAACGA
CGTCAAGGGCCTGTTGTGGCTTACCCGGGTGAAATTCGATGACTAA