SecReT6
Protein ID: 146305136
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0095
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]90186..91976 [+]
Producthypothetical protein
NoteTssF
UniProt IDA4XNF3
KEGG IDpmy:Pmen_0095
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-187, Aligned region: 3..596
Protein Sequence: 596 a.a.     [Download]
>gi|146305136|ref|YP_001185601.1| unnamed protein product [Pseudomonas mendocina ymp]
MSFNHYYQSELTALRQLGKRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MHLLWPNYMRPLPAFSMLQFDPLTRPGPALPVKRGTPVEAKAIEGVTCRFRTCYPTEVLPLALNGLDYSV
KGDGALLSLRLGMSADGHLGEIGLNKLRLHLAGERYIGQMLYLALLRNLGGIQLVLLDAAGKPMQDAFGQ
TLGTLQLKPEQVQPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDLLGLDAIHGLPEDLLKQAR
GLELRFDIHKAGVQRIRPTLENVRLYCTPVVNLFQHDAIPIRLDGKQDQYLLLPAEFDAQHCGVFSVDRV
TGWKPGGMGYEEYVPFESFEHDPSFDVPVARPHYSVRQQPSMLGDGLETWLSFGLRNLDQHETLSIELTC
TNQNLPRQLSLGDICLPSEDTPDFLSFRNISAVTPCYAPPLHRDFLWKLISNMSLNYLSLANVEALKVIL
ETYDLPRYYDQHAERVSKRLLGGLKSIGHRHVDRLHRGLPVRGVRTELTMNPDGYLGEGDLFLFASVLNE
FFALYASLNSYHELHVQSTQGELYKWTPRMGQQPLL
 
Nucleotide Sequence: 1791 bp     [Download]
>gi|146305042|ref|NC_009439.1|:90186-91976 Pseudomonas mendocina ymp chromosome, complete genome
ATGTCTTTTAACCACTACTACCAAAGCGAACTCACCGCCCTGCGCCAACTGGGCAAGCGCTTTGCCGAGC
GCAGCCCGGCGCTGGCGCCGTTTCTTGGCCAGGCCGGGCGTGATCCGGATGTCGAGCGCCTGCTCGAAGG
CTTCGCCTTCCTTACCGGGCGTCTGCGGCAGAAGCTCGACGACGAGCTTCCGGAGCTGACCCACTCGCTG
ATGCACCTGCTGTGGCCGAACTACATGCGTCCGCTACCGGCCTTCAGCATGCTCCAGTTCGACCCGCTGA
CCCGTCCCGGTCCGGCGTTGCCGGTCAAGCGCGGCACGCCGGTGGAGGCCAAGGCCATCGAGGGCGTCAC
CTGCCGCTTTCGCACCTGCTACCCCACCGAGGTGCTGCCGCTGGCGCTGAACGGCCTGGACTACTCGGTG
AAGGGCGACGGCGCGCTGCTCAGCCTGCGTCTGGGCATGAGCGCCGACGGCCATCTCGGCGAGATCGGCC
TGAACAAGCTGCGTCTGCACCTGGCCGGCGAGCGCTATATCGGCCAGATGCTCTACCTGGCGCTGCTGCG
CAACCTCGGCGGCATCCAGCTGGTGCTGCTCGATGCCGCCGGCAAGCCCATGCAGGATGCCTTTGGCCAG
ACTCTCGGCACCTTGCAGCTCAAGCCCGAGCAGGTGCAGCCGGTGGGCTTCGCCGAGGACGAGGCGCTGA
TCCCCTATCCGCTCAACACCTTCCGCGGTTATCGCTACCTGCAGGAATACTTCGCCTTCCAGGACAAGTT
CCTCTTCGTCGACCTGCTCGGCCTGGATGCCATCCACGGCCTGCCCGAGGATCTGCTCAAGCAGGCGCGC
GGCCTGGAGCTGCGCTTCGATATCCACAAGGCCGGCGTGCAGCGCATCCGCCCGACCCTGGAAAACGTGC
GCCTGTACTGCACCCCGGTGGTCAACCTGTTCCAGCACGACGCCATCCCGATCCGCCTCGACGGCAAGCA
GGACCAGTACCTGCTGCTGCCGGCCGAATTCGACGCGCAGCACTGCGGCGTGTTCTCGGTGGACCGCGTC
ACCGGCTGGAAGCCGGGCGGCATGGGCTACGAGGAGTACGTGCCGTTCGAGTCGTTCGAGCACGACCCCA
GCTTCGACGTGCCGGTGGCGCGCCCGCACTACAGCGTGCGTCAGCAGCCGTCGATGCTCGGCGACGGCCT
GGAGACCTGGCTCAGCTTCGGTCTGCGCAACCTCGACCAGCACGAGACGCTGTCCATCGAGCTGACCTGC
ACCAACCAGAATCTGCCGCGTCAGCTGAGCCTGGGCGATATCTGCCTGCCCAGCGAGGACACCCCGGATT
TTCTCAGCTTCCGCAACATCAGCGCGGTCACGCCTTGCTATGCGCCGCCGCTGCACCGCGACTTCCTGTG
GAAGCTGATTTCCAACATGTCGCTGAACTACCTGTCGCTGGCCAACGTCGAGGCGCTCAAGGTGATCCTC
GAGACCTACGACCTGCCGCGCTACTACGACCAGCACGCCGAGCGCGTCAGCAAGCGCCTGCTCGGTGGCC
TCAAGAGCATCGGCCACCGCCATGTCGACCGCCTGCACCGCGGCCTGCCGGTACGCGGCGTGCGCACCGA
ACTGACCATGAACCCGGACGGCTACCTGGGCGAGGGCGACCTGTTCCTCTTCGCCTCGGTACTCAATGAA
TTTTTCGCCCTCTACGCCAGCCTCAACAGCTACCACGAGCTGCACGTACAGAGCACACAGGGAGAGTTGT
ACAAATGGACGCCACGCATGGGGCAGCAGCCCCTGCTCTGA