SecReT6
Protein ID: 146305137
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0096
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]91940..92947 [+]
Producthypothetical protein
NoteTssG
UniProt IDA4XNF4
KEGG IDpmy:Pmen_0096
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-87, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|146305137|ref|YP_001185602.1| unnamed protein product [Pseudomonas mendocina ymp]
MDATHGAAAPALNRLSRGIREYSLFQAVQLVLERLKVAHPQLDDERLYEYLEFQANPSLGFPGSDIDRVQ
FFEEHGELRARMRVNLVGLFGGGSPLPAFYSEQALGDSEDGNPTRDFLDLFNNRLQRLLLPIWQKYRYRA
SFQSGAMDAFSAHLFALIGLGSEQIRQAQELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELFIEQ
CLERQVVVLEEQRNRLGRANSLLGEDTVLGERVRDRGGKFRIHVRQLGWTRFHEFLPIGTGYQPLCALVR
FTLRDPLDYDIRLELRQDEIRDLRIGEGNPCLLGWTTWLGRENADGLVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|146305042|ref|NC_009439.1|:91940-92947 Pseudomonas mendocina ymp chromosome, complete genome
ATGGACGCCACGCATGGGGCAGCAGCCCCTGCTCTGAACCGGCTCAGCCGGGGCATCCGCGAGTACAGCC
TGTTCCAGGCCGTACAGCTGGTGCTGGAGCGCCTCAAGGTTGCCCATCCGCAACTGGATGACGAGCGCCT
CTACGAGTACCTGGAATTCCAGGCCAACCCGAGCCTGGGTTTCCCCGGCAGCGATATCGATCGCGTGCAG
TTCTTCGAGGAGCACGGCGAGCTGCGCGCGCGCATGCGCGTCAACCTGGTCGGCCTGTTCGGCGGCGGCT
CGCCGTTGCCGGCCTTCTACAGCGAACAGGCCCTGGGTGACAGCGAGGACGGCAACCCGACCCGCGACTT
CCTCGACCTGTTCAACAACCGTCTGCAGCGCCTGTTGCTGCCGATCTGGCAGAAGTACCGCTACCGCGCC
AGCTTCCAGAGCGGGGCGATGGACGCCTTCTCCGCGCACCTGTTCGCCCTGATCGGCCTGGGCAGCGAGC
AGATCCGCCAGGCCCAGGAGCTGAACTGGAAGCGCCTGCTGCCCTACCTCGGCCTGCTCAGCCTGCGTGC
CCACTCGGCAGCGCTGATCGAGTCGGTGCTGCGTTACTACTTCAAGCACGCCGAGCTGTTCATCGAGCAG
TGTCTGGAGCGCCAGGTGGTGGTGCTGGAAGAGCAGCGCAACCGCCTCGGCCGCGCCAACAGCCTGCTCG
GCGAAGACACCGTGCTCGGCGAGCGCGTCCGCGACCGCGGCGGCAAGTTCCGCATCCACGTGCGCCAGCT
GGGCTGGACGCGCTTTCACGAGTTCCTGCCGATCGGCACGGGTTACCAGCCGCTCTGCGCGCTGGTGCGC
TTCACCCTGCGCGATCCGCTGGACTACGACATCCGCCTGGAGCTGCGTCAGGACGAAATCCGCGACCTGC
GCATCGGCGAAGGCAACCCCTGCCTGCTGGGCTGGACCACCTGGCTCGGCCGTGAGAACGCCGACGGTCT
GGTCACCCTCGGCAGCAAGATTCATTAA