SecReT6
Protein ID: 146305138
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0097
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]92959..95559 [+]
ProductATPase
NoteTssH
UniProt IDA4XNF5
KEGG IDpmy:Pmen_0097
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-43, Aligned region: 206..226
AAA_2 [PF07724], Evalue: 3.20E-43, Aligned region: 600..765
AAA [PF00004], Evalue: 3.70E-19, Aligned region: 208..339
AAA [PF00004], Evalue: 3.70E-19, Aligned region: 605..723
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 208..228
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 306..338
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 604..723
AAA_16 [PF13191], Evalue: 5.30E-11, Aligned region: 63..118
AAA_16 [PF13191], Evalue: 5.30E-11, Aligned region: 186..229
AAA_16 [PF13191], Evalue: 5.30E-11, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 5.30E-11, Aligned region: 446..520
AAA_16 [PF13191], Evalue: 5.30E-11, Aligned region: 575..628
AAA_16 [PF13191], Evalue: 5.30E-11, Aligned region: 669..698
AAA_16 [PF13191], Evalue: 5.30E-11, Aligned region: 767..790
ClpB_D2-small [PF10431], Evalue: 5.10E-09, Aligned region: 775..844
AAA_22 [PF13401], Evalue: 1.90E-08, Aligned region: 207..303
AAA_22 [PF13401], Evalue: 1.90E-08, Aligned region: 603..709
AAA_22 [PF13401], Evalue: 1.90E-08, Aligned region: 817..856
NACHT [PF05729], Evalue: 5.70E-06, Aligned region: 208..236
NACHT [PF05729], Evalue: 5.70E-06, Aligned region: 604..644
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 205..230
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 602..631
AAA_17 [PF13207], Evalue: 1.90E-05, Aligned region: 208..256
AAA_17 [PF13207], Evalue: 1.90E-05, Aligned region: 603..639
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 264..304
AAA_25 [PF13481], Evalue: 2.30E-05, Aligned region: 601..636
Sigma54_activat [PF00158], Evalue: 2.90E-05, Aligned region: 203..222
Sigma54_activat [PF00158], Evalue: 2.90E-05, Aligned region: 603..723
Clp_N [PF02861], Evalue: 5.40E-05, Aligned region: 32..72
Clp_N [PF02861], Evalue: 5.40E-05, Aligned region: 102..122
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 202..229
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 604..622
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 208..228
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 605..649
AAA_29 [PF13555], Evalue: 0.00043, Aligned region: 201..224
AAA_29 [PF13555], Evalue: 0.00043, Aligned region: 602..629
ResIII [PF04851], Evalue: 0.00054, Aligned region: 191..230
ResIII [PF04851], Evalue: 0.00054, Aligned region: 278..289
ResIII [PF04851], Evalue: 0.00054, Aligned region: 575..638
DUF258 [PF03193], Evalue: 0.0015, Aligned region: 175..232
DUF258 [PF03193], Evalue: 0.0015, Aligned region: 603..616
AAA_14 [PF13173], Evalue: 0.005, Aligned region: 208..311
AAA_14 [PF13173], Evalue: 0.005, Aligned region: 603..698
AAA_23 [PF13476], Evalue: 0.0056, Aligned region: 208..233
AAA_23 [PF13476], Evalue: 0.0056, Aligned region: 460..520
AAA_23 [PF13476], Evalue: 0.0056, Aligned region: 602..631
Arch_ATPase [PF01637], Evalue: 0.0058, Aligned region: 188..222
Arch_ATPase [PF01637], Evalue: 0.0058, Aligned region: 260..292
Arch_ATPase [PF01637], Evalue: 0.0058, Aligned region: 555..587
Arch_ATPase [PF01637], Evalue: 0.0058, Aligned region: 603..617
Arch_ATPase [PF01637], Evalue: 0.0058, Aligned region: 675..686
T2SE [PF00437], Evalue: 0.0089, Aligned region: 183..228
T2SE [PF00437], Evalue: 0.0089, Aligned region: 588..682
Protein Sequence: 866 a.a.     [Download]
>gi|146305138|ref|YP_001185603.1| unnamed protein product [Pseudomonas mendocina ymp]
MINVDLQQLVQALDAASKRDLEMAAERCVVRGGNKILVEDLLLGLLERPESLLARALQDAEIDAGELAQA
LQPRGEHSESRNPVFSAELVQWLQDALLVANLELGASQIDQAALILALLRNPMRYAGSRYQTLLSKLNAE
RLRDFALSQQPQAAGGKAAAPGESNLARFTHNFTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPIVV
GEAGVGKTAIVEGLALRIATGEVPQVLKGVELLCLDLGLLQAGASVKGEFERRLQGVIDEVKASPKPIIL
FIDEAHTLIGAGGQAGSGDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQPVQLHEPTVDE
AVTILRGLAPVYEKSHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPEALERL
RGEIAEGERQGEAMRRDLDAGLSIDGEALDALETRLVAARAELEQVETRWAIQRDLAERLLEQRKQCAAA
RLAGDAEETDEPRASLEELEAELRALQAELAAAQASERLVSFEVCPRLVAEVISHWTGVPLSQLAREHNT
KVITFADDLRQRVRGQEQAIQALDKAMRATAAGLNRPDAPVGVFLLVGPSGVGKTETALALADLLYGGER
FLTVINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDVMNVFYQIFDKG
VANDGEGREINFRNTLILMTSNLASERIASLCAGGERPGAEDLELAIRPQLTQHFKPALLGRMRVVPYYP
MDGDLLRQLVGLKLARFGERLARRQLAFSHCDGLVEHLAERCTHGDSGARLIDHLIDQHLQPLVVDRLLD
AMASGETLQQVRATLNGEGTVVCEFA
 
Nucleotide Sequence: 2601 bp     [Download]
>gi|146305042|ref|NC_009439.1|:92959-95559 Pseudomonas mendocina ymp chromosome, complete genome
ATGATCAACGTCGACCTGCAACAACTGGTTCAAGCTCTGGACGCCGCGAGCAAGCGCGACCTGGAGATGG
CCGCCGAACGCTGCGTGGTACGCGGCGGCAACAAGATCCTCGTCGAGGACCTGCTGCTGGGTCTGCTCGA
GCGCCCGGAAAGCCTGCTGGCGCGTGCCCTGCAGGATGCCGAGATCGATGCCGGCGAGCTGGCCCAGGCG
CTGCAGCCGCGCGGCGAGCACAGCGAGTCGCGCAACCCGGTGTTTTCTGCCGAACTGGTGCAGTGGCTGC
AGGACGCCCTGCTGGTGGCCAACCTGGAGCTGGGCGCCAGCCAGATCGACCAGGCCGCGCTGATCCTCGC
CCTGCTGCGCAACCCCATGCGCTACGCCGGCAGCCGTTATCAGACGCTGCTGAGCAAGCTCAATGCCGAG
CGTCTGCGCGACTTCGCCCTTAGCCAGCAGCCGCAGGCCGCGGGCGGCAAAGCGGCGGCGCCGGGCGAGT
CGAACCTGGCGCGCTTTACCCACAACTTCACCCAGCAGGCCCGCGACGGCAAGCTCGATCCGGTGCTGTG
CCGCGACGGCGCGATCCGCCAGATGGTCGATATCCTCGCCCGCCGGCGCAAGAACAACCCCATCGTGGTC
GGCGAGGCCGGGGTGGGCAAGACCGCCATCGTCGAGGGCCTGGCCCTGCGCATCGCCACCGGCGAGGTAC
CGCAGGTGCTCAAGGGCGTCGAGCTGCTGTGCCTGGACCTCGGCCTGCTGCAGGCCGGCGCCAGCGTCAA
GGGCGAGTTCGAGCGCCGCTTGCAGGGCGTGATCGACGAGGTCAAGGCCTCGCCCAAGCCGATCATCCTG
TTTATCGACGAGGCCCATACGCTGATCGGGGCCGGTGGCCAGGCCGGCAGCGGCGATGCCGCCAACCTGC
TCAAGCCGGCGCTGGCCCGTGGCGAGCTGCGCACCATCGCCGCCACCACCTGGAGCGAATACAAGAAGTA
CTTCGAGAAGGACCCGGCGCTGGCCCGTCGCTTCCAGCCGGTGCAACTGCACGAGCCGACCGTCGACGAG
GCGGTGACCATCCTGCGCGGCCTGGCGCCGGTGTACGAGAAGAGCCACGGCATCTACCTGCGCGACGACG
CCGTGGTCGCCGCCGCCGAGCTGTCGGCGCGCTACCTGGCCGGTCGCCAGTTGCCGGACAAGGCGGTGGA
CGTACTCGACACCGCCTGCGCCCGCGTGCGCATCAGCCTGGCCGCCGCACCCGAGGCGCTGGAGCGCCTG
CGCGGCGAGATCGCCGAGGGCGAGCGCCAGGGCGAGGCCATGCGCCGCGACCTGGACGCTGGCCTGAGCA
TCGACGGCGAAGCGCTGGATGCCCTGGAAACCCGCCTGGTCGCCGCGCGCGCCGAACTGGAGCAGGTGGA
AACCCGCTGGGCGATCCAGCGCGACCTGGCCGAGCGCCTGCTCGAGCAGCGCAAGCAGTGCGCCGCGGCG
CGTCTTGCTGGCGACGCAGAGGAAACCGACGAGCCACGTGCCAGCCTGGAGGAACTGGAAGCCGAGCTGC
GCGCCCTCCAGGCCGAGCTGGCCGCGGCTCAGGCCAGCGAGCGCCTGGTCAGCTTCGAGGTCTGCCCGCG
CCTGGTGGCCGAGGTGATCAGCCACTGGACCGGCGTGCCGCTGAGCCAGCTGGCGCGCGAGCACAACACC
AAGGTCATCACCTTCGCCGACGACCTGCGCCAGCGCGTGCGCGGCCAGGAGCAGGCGATCCAGGCGCTGG
ACAAGGCCATGCGCGCCACCGCTGCCGGCCTCAACCGGCCCGATGCGCCAGTGGGCGTGTTCCTCCTGGT
CGGCCCCAGCGGCGTCGGCAAGACCGAGACCGCCCTGGCCCTGGCCGACCTGCTGTATGGCGGTGAACGC
TTCCTCACCGTGATCAACATGTCCGAGTTCCAGGAAAAACATACCGTCTCGCGTCTGATCGGCGCGCCGC
CCGGCTACGTCGGCTACGGCGAAGGCGGCATGCTCACCGAAGCCGTGCGGCAGAAGCCCTACTCGGTGAT
CCTCCTCGACGAGGTGGAGAAGGCCGACCCCGACGTGATGAACGTCTTCTACCAGATCTTCGACAAGGGC
GTGGCCAACGACGGCGAAGGGCGCGAGATCAACTTCCGCAACACCCTGATCCTGATGACCAGCAACCTGG
CCAGCGAACGCATCGCCAGCCTGTGCGCCGGTGGTGAGCGCCCGGGGGCCGAGGACCTGGAGCTGGCCAT
CCGCCCGCAACTGACCCAGCACTTCAAGCCGGCCCTGCTCGGCCGTATGCGCGTGGTGCCCTACTACCCC
ATGGACGGCGACCTGCTGCGCCAGCTGGTCGGCCTCAAGCTGGCCCGTTTCGGCGAGCGCCTGGCCCGTC
GCCAGCTCGCCTTCAGCCACTGCGACGGCCTGGTCGAGCACCTGGCCGAGCGCTGTACCCATGGCGACAG
CGGCGCCCGTCTGATCGACCACCTGATCGACCAGCACCTGCAGCCGCTGGTGGTCGACCGCCTGCTCGAC
GCCATGGCGAGCGGCGAGACCTTGCAGCAGGTACGCGCCACCCTGAACGGTGAAGGAACGGTGGTCTGTG
AGTTCGCTTAA