SecReT6
Protein ID: 146305141
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0100
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]97281..98477 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA4XNF8
KEGG IDpmy:Pmen_0100
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-12, Aligned region: 29..97
FHA [PF00498], Evalue: 1.60E-12, Aligned region: 358..380
Protein Sequence: 398 a.a.     [Download]
>gi|146305141|ref|YP_001185606.1| unnamed protein product [Pseudomonas mendocina ymp]
MELVFEMVSAQQFVPGLLTTKTFKQAGGVIGRAEDCDWVIPDRKRILSSRHAEVSYRDGAFYLTDTSSNG
IALKDSGASLAKGRPQRIEHGSVYCLGDFEIRARLIQDPAMFEGDIGLPQAAGSIIPDDAFLDLDPLTAL
EQQERVYAEVDDLTAVLRPSTAQAQQRDYAQIDEENLLVPELVMPTPPAQPKPAPEPERLPPSFWEKFAD
ALGVRLDDLDDDAREALALNAAKLLRQSVGSLQQALRTRGELKNELRLALTTVQGAGNNPLKHGLDSGET
LTALLRGGKPGQLPAEQAISRGFRDLQAHQVALLAASRAAVKGMFEQFAPEQLAMRFERNGRKPLLATAG
SRWRAYRRLHADLAQNDDWSDRLFTRDFASAYEEQVRLIATLNTDLQG
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|146305042|ref|NC_009439.1|:97281-98477 Pseudomonas mendocina ymp chromosome, complete genome
ATGGAACTGGTATTCGAGATGGTCAGCGCACAGCAGTTCGTGCCGGGTCTGCTGACCACCAAGACCTTCA
AACAGGCTGGCGGCGTGATCGGTCGCGCCGAGGATTGCGACTGGGTGATCCCCGATCGCAAGCGCATCCT
CTCCAGCCGTCATGCCGAGGTCAGCTATCGCGATGGCGCCTTCTACCTGACCGACACCAGCAGCAACGGC
ATCGCCCTCAAGGACAGCGGCGCCAGCCTGGCCAAGGGCCGCCCGCAGCGTATCGAGCACGGCAGCGTGT
ACTGCCTGGGCGACTTCGAGATTCGCGCACGGCTGATTCAGGATCCGGCCATGTTCGAGGGCGATATCGG
CCTGCCGCAGGCAGCCGGCAGCATCATCCCCGACGACGCCTTCCTCGACCTCGACCCGCTCACCGCGCTG
GAGCAGCAGGAGCGCGTCTACGCCGAGGTGGACGATCTGACCGCCGTGCTGCGCCCCAGCACCGCCCAGG
CGCAGCAGCGCGACTACGCGCAGATCGACGAGGAAAACCTGCTGGTGCCCGAGCTGGTGATGCCGACGCC
GCCGGCCCAGCCGAAACCCGCGCCGGAGCCCGAGCGCCTGCCGCCGAGCTTCTGGGAAAAGTTCGCCGAT
GCCCTCGGCGTGCGCCTCGACGATCTCGATGACGATGCCCGCGAAGCCCTGGCGCTCAATGCCGCCAAGC
TGCTCAGGCAGAGCGTCGGCAGCCTGCAGCAGGCCCTGCGCACGCGCGGCGAGCTGAAGAACGAGCTGCG
TCTGGCCCTGACCACCGTGCAGGGCGCCGGTAACAACCCGCTCAAGCACGGCCTGGATAGCGGGGAGACG
CTGACCGCCCTGCTGCGTGGCGGCAAACCCGGTCAGCTGCCTGCCGAGCAGGCCATCAGCCGCGGCTTTC
GCGACCTGCAGGCGCACCAGGTGGCGTTGCTCGCCGCCAGCCGCGCGGCGGTCAAGGGCATGTTCGAGCA
GTTCGCCCCGGAGCAGCTGGCCATGCGCTTCGAACGCAACGGCCGCAAGCCGCTGCTCGCCACCGCCGGC
AGCCGCTGGCGCGCCTACCGCCGCCTGCATGCGGATCTGGCGCAGAACGACGACTGGAGCGACCGCCTGT
TCACCCGCGATTTCGCCAGTGCCTACGAAGAGCAGGTTCGCCTGATCGCCACCCTCAATACCGACCTTCA
AGGATGA